NME2P1 (NME2 pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 283458
Gene name NME2 pseudogene 1
Gene symbol NME2P1
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12q24.23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004550 Function Nucleoside diphosphate kinase activity IBA
GO:0004550 Function Nucleoside diphosphate kinase activity IEA
GO:0005515 Function Protein binding IPI 28514442, 33961781
GO:0005524 Function ATP binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 31358 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O60361
Protein name Putative nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6)
Protein function Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00334 NDK 1 → 124 Nucleoside diphosphate kinase Domain
Sequence 
MQCGLVGKIIKRFEQKGFRLVAMKFLPASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVA
MVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLRFK
PEELVDYKSCAHDWVYE
Sequence length 137
Interactions View interactions

No strongly related genes found yet for NME2P1.

No additional diseases found yet through genes similar to NME2P1.