NLRP2B (NLR family pyrin domain containing 2B) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	286430
Gene name	NLR family pyrin domain containing 2B
Gene symbol	NLRP2B
Synonyms (NCBI Gene)	CLRX.1NALP2PNLRP2PNOD24POP4
Chromosome	X
Chromosome location	Xp11.21

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005634	Component	Nucleus	IDA	24871464
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	24871464
GO:0005737	Component	Cytoplasm	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010804	Process	Negative regulation of tumor necrosis factor-mediated signaling pathway	IMP	24871464
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	24871464
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IMP	24871464
GO:0033137	Process	Negative regulation of peptidyl-serine phosphorylation	IMP	24871464
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IMP	24871464
GO:0043065	Process	Positive regulation of apoptotic process	IMP	24871464
GO:0045087	Process	Innate immune response	IEA
GO:0045786	Process	Negative regulation of cell cycle	IMP	24871464
GO:1900226	Process	Negative regulation of NLRP3 inflammasome complex assembly	IMP	24871464

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	P0DMW2
Protein name	NLR family pyrin domain-containing protein 2B (Pyrin domain-containing protein 2-like protein POP4) (Pyrin-only protein 4)
Protein function	May function as a negative regulator of NF-kappa-B by preventing RELA/p65 phosphorylation at 'Ser-536', thereby inhibiting its transcriptional activity. Through NF-kappa-B regulation may control cytokine release upon Toll-like receptors activati
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Expressed in all tissues tested, including spleen, lymph node, thymus, tonsil, peripheral blood leukocyte, bone marrow, liver, heart, brain, placenta, lung, skeletal muscle, kidney and pancreas. {ECO:0000269\|PubMed:24871464}.
Sequence	MVSSAQLDFNLQALLGQLSQDDLCKFKSLIRTVSLGNELQKIPQT
Sequence length	45
Interactions	View interactions