NKX2-8 (NK2 homeobox 8)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 26257
• Gene name: NK2 homeobox 8
• Gene symbol: NKX2-8
• Synonyms (NCBI Gene): NKX2.8, NKX2H, Nkx2-9
• Chromosome: 14
• Chromosome location: 14q13.3
• Summary: The protein encoded by this gene is a homeobox-containing developmental regulator associated with liver development. The encoded protein binds to the alpha-fetoprotein (AFP) gene promoter and increases the expression of AFP. This gene is overexpressed in

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2283219	hsa-miR-4725-5p	CLIP-seq
MIRT2283220	hsa-miR-4783-5p	CLIP-seq
MIRT2283221	hsa-miR-504	CLIP-seq
MIRT2283222	hsa-miR-566	CLIP-seq

Gene ontology (GO) Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12167706
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12167706
GO:0001889	Process	Liver development	NAS	9446603
GO:0003677	Function	DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IDA	9446603
GO:0003700	Function	DNA-binding transcription factor activity	IDA	9446603
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006351	Process	DNA-templated transcription	IDA	9446603
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9446603
GO:0007409	Process	Axonogenesis	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030323	Process	Respiratory tube development	IEA
GO:0030324	Process	Lung development	IEA
GO:0043565	Function	Sequence-specific DNA binding	IDA	12167706
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12167706
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 603245
• HGNC: 16364
• e!Ensembl: ENSG00000136327

Protein

• UniProt ID: O15522
• Protein name: Homeobox protein Nkx-2.8 (Homeobox protein NK-2 homolog H)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00046	Homeodomain	85 → 141	Homeodomain	Domain

• Sequence:

  MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLE
  TSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASL
  LRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQP
  CGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW

• Sequence length: 239

Related Genes

No strongly related genes found yet for NKX2-8.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NKX2-8.