NKX1-2 (NK1 homeobox 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 390010
Gene name NK1 homeobox 2
Gene symbol NKX1-2
Synonyms (NCBI Gene)
C10orf121NKX-1.1SAX1bB238F13.2
Chromosome 10
Chromosome location 10q26.13
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
621058 31652 ENSG00000229544
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UD57
Protein name NK1 transcription factor-related protein 2 (Homeobox protein SAX-1) (NKX-1.1)
Protein function Transcriptional repressor. May play a role in early development as a Wnt/beta-catenin effector, hence controlling pluripotency and preimplantation development of embryonic stem cells. May promote adipogenesis in mesenchymal stem cells, possibly
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 164 → 220 Homeodomain Domain
Sequence 
MLAWQDGGAKAAPSHHKISFSVLDILDPQKFTRAALPAVRPAPREARKSLAEVEAGKDAS
SRDPVRQLETPDAAGPGAGQASPLEGSEAEEEEDAEDPRRPRLRERAARLLPGLARSPDA
PAGALASGEPCEDGGGGPVRSPPGSPGSPRPRRRRLEPNCAKPRRARTAFTYEQLVALEN
KFRATRYLSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADGAAQVGGGAPQPGA
AGGGGGGGSGGSPGPPGTGALHFQTFPSYSAANVLFPSAASFPLTAAAPGSPFAPFLGPS
YLTPFYAPRL
Sequence length 310
Interactions View interactions

No strongly related genes found yet for NKX1-2.

No additional diseases found yet through genes similar to NKX1-2.