NKAIN2 (sodium/potassium transporting ATPase interacting 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 154215
• Gene name: Sodium/potassium transporting ATPase interacting 2
• Gene symbol: NKAIN2
• Synonyms (NCBI Gene): FAM77B, NKAIP2, TCBA, TCBA1
• Chromosome: 6
• Chromosome location: 6q22.31
• Summary: This gene encodes a transmembrane protein that interacts with the beta subunit of a sodium/potassium-transporting ATPase. A chromosomal translocation involving this gene is a cause of lymphoma. Alternative splicing results in multiple transcript variants

miRNA Show/Hide all (44)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017569	hsa-miR-335-5p	Microarray	18185580
MIRT1186022	hsa-miR-1224-3p	CLIP-seq
MIRT1186023	hsa-miR-1260	CLIP-seq
MIRT1186024	hsa-miR-1260b	CLIP-seq
MIRT1186025	hsa-miR-1280	CLIP-seq
MIRT1186026	hsa-miR-3171	CLIP-seq
MIRT1186027	hsa-miR-3907	CLIP-seq
MIRT1186028	hsa-miR-4802-5p	CLIP-seq
MIRT1186029	hsa-miR-626	CLIP-seq
MIRT1186030	hsa-miR-1244	CLIP-seq
MIRT1186031	hsa-miR-297	CLIP-seq
MIRT1186032	hsa-miR-3064-3p	CLIP-seq
MIRT1186033	hsa-miR-3674	CLIP-seq
MIRT1186034	hsa-miR-369-3p	CLIP-seq
MIRT1186035	hsa-miR-374c	CLIP-seq
MIRT1186036	hsa-miR-3924	CLIP-seq
MIRT1186037	hsa-miR-3935	CLIP-seq
MIRT1186038	hsa-miR-4328	CLIP-seq
MIRT1186039	hsa-miR-4666-5p	CLIP-seq
MIRT1186040	hsa-miR-4727-5p	CLIP-seq
MIRT1186041	hsa-miR-4769-3p	CLIP-seq
MIRT1186042	hsa-miR-544	CLIP-seq
MIRT1186043	hsa-miR-567	CLIP-seq
MIRT1186044	hsa-miR-606	CLIP-seq
MIRT1186045	hsa-miR-655	CLIP-seq
MIRT2283105	hsa-miR-140-3p	CLIP-seq
MIRT2283106	hsa-miR-3117-3p	CLIP-seq
MIRT2283107	hsa-miR-3156-5p	CLIP-seq
MIRT2283108	hsa-miR-3169	CLIP-seq
MIRT2283109	hsa-miR-4695-3p	CLIP-seq
MIRT2283110	hsa-miR-4759	CLIP-seq
MIRT2283111	hsa-miR-651	CLIP-seq
MIRT2283112	hsa-miR-888	CLIP-seq
MIRT2283106	hsa-miR-3117-3p	CLIP-seq
MIRT2283108	hsa-miR-3169	CLIP-seq
MIRT2283110	hsa-miR-4759	CLIP-seq
MIRT2283111	hsa-miR-651	CLIP-seq
MIRT2581362	hsa-miR-145	CLIP-seq
MIRT2581363	hsa-miR-2115	CLIP-seq
MIRT2581364	hsa-miR-3160-5p	CLIP-seq
MIRT2581365	hsa-miR-4712-5p	CLIP-seq
MIRT2581366	hsa-miR-516a-3p	CLIP-seq
MIRT1186042	hsa-miR-544	CLIP-seq
MIRT2581367	hsa-miR-770-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002028	Process	Regulation of sodium ion transport	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 609758
• HGNC: 16443
• e!Ensembl: ENSG00000188580

Protein

• UniProt ID: Q5VXU1
• Protein name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2 (Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2) (Protein FAM77B) (T-cell lymphoma breakpoint-associated target protein 1)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05640	NKAIN	1 → 207	Na,K-Atpase Interacting protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal brain. Weakly expressed in adult brain and thymus. Not expressed in any other normal tissue examined. {ECO:0000269|PubMed:11979551}.
• Sequence:

  MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPR
  YITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSV
  TPAPDWAPEDHRYITVSGCLLEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFD
  FIGGFDSYGYQGPQKTSHLQLQPMYMSK

• Sequence length: 208

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (28)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	23535033	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	41022758	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BENIGN NEOPLASM OF ADRENAL GLAND	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY ATRESIA	—	GWAS catalog	37572794	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	34099189	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	24999842	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	34982113	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565, 35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	40341939	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	34099189, 37464041, 38177345	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	20634892	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	37154150	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	33987465	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	24024966	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	23894747, 34099189, 35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	38162683	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	31488892	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (25)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23535033		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23535033		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	GWASDB_DG	24999842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	GWASCAT_DG	24999842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11979551		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	15908570		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15908570		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28381166		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27588475		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27588475		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24205241		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24205241	Associate	★☆☆☆☆ Found in Text Mining only
Neurotic Disorders	Neurotic Disorders	GWASCAT_DG	20634892		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	20634892		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	GWASDB_DG	20634892		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28381166		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28381166	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	GWASCAT_DG	24024966		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontosis	Periodontosis	GWASCAT_DG	24024966		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27588475		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27588475	Inhibit	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	34099189	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	11979551		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	11979551, 15908570		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

WSCD1 3 shared diseasesEssential tremor, Hypotension, Non-small cell lung carcinoma 3 shared evidence sourcesGWAS catalog (Essential tremor), GWAS catalog (Hypotension), GWAS catalog (Non-small cell lung carcinoma) Related via 3 shared diseases including Essential tremor, Hypotension — evidence mostly GWAS catalog. ADGRE1 2 shared diseasesBiliary atresia, Periodontitis 2 shared evidence sourcesGWAS catalog (Biliary atresia), GWAS catalog (Periodontitis) Related via 2 shared diseases including Biliary atresia, Periodontitis — evidence mostly GWAS catalog. STK32B 2 shared diseasesCeliac disease, Essential tremor 2 shared evidence sourcesGWAS catalog (Celiac disease), GWAS catalog (Essential tremor) Related via 2 shared diseases including Celiac disease, Essential tremor — evidence mostly GWAS catalog. NLRP1 3 shared diseasesEssential tremor, Hypotension, Non-small cell lung carcinoma 3 shared evidence sourcesGWAS catalog (Essential tremor), GWAS catalog (Hypotension), GWAS catalog (Non-small cell lung carcinoma) Related via 3 shared diseases including Essential tremor, Hypotension — evidence mostly GWAS catalog. ANKFN1 2 shared diseasesBiliary atresia, Celiac disease 2 shared evidence sourcesGWAS catalog (Biliary atresia), GWAS catalog (Celiac disease) Related via 2 shared diseases including Biliary atresia, Celiac disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
WSCD1	3	["Essential tremor","Hypotension","Non-small cell lung carcinoma"]	0	[]	3	["GWAS catalog (Essential tremor)","GWAS catalog (Hypotension)","GWAS catalog (Non-small cell lung carcinoma)"]
ADGRE1	2	["Biliary atresia","Periodontitis"]	0	[]	2	["GWAS catalog (Biliary atresia)","GWAS catalog (Periodontitis)"]
STK32B	2	["Celiac disease","Essential tremor"]	0	[]	2	["GWAS catalog (Celiac disease)","GWAS catalog (Essential tremor)"]
NLRP1	3	["Essential tremor","Hypotension","Non-small cell lung carcinoma"]	0	[]	3	["GWAS catalog (Essential tremor)","GWAS catalog (Hypotension)","GWAS catalog (Non-small cell lung carcinoma)"]
ANKFN1	2	["Biliary atresia","Celiac disease"]	0	[]	2	["GWAS catalog (Biliary atresia)","GWAS catalog (Celiac disease)"]

Diseases Linked via Similar Genes

Corneal neovascularization Linked via 2 of 5 related genesWSCD1, NLRP1 Irritable bowel syndrome Linked via 2 of 5 related genesWSCD1, NLRP1 Keratitis Linked via 2 of 5 related genesWSCD1, NLRP1 Migraine Linked via 2 of 5 related genesWSCD1, NLRP1 Ovarian cancer Linked via 2 of 5 related genesWSCD1, NLRP1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Corneal neovascularization	2	["WSCD1","NLRP1"]
Irritable bowel syndrome	2	["WSCD1","NLRP1"]
Keratitis	2	["WSCD1","NLRP1"]
Migraine	2	["WSCD1","NLRP1"]
Ovarian cancer	2	["WSCD1","NLRP1"]