Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	60491
Gene name	NGG1 interacting factor 3 like 1
Gene symbol	NIF3L1
Synonyms (NCBI Gene)	ALS2CR1CALS-7MDS015
Chromosome	2
Chromosome location	2q33.1

79 Show/Hide all (79)

miRTarBase ID	miRNA	Experiments	Reference
MIRT691201	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT691200	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT691199	hsa-miR-4257	HITS-CLIP	23313552
MIRT691198	hsa-miR-4270	HITS-CLIP	23313552
MIRT691197	hsa-miR-4441	HITS-CLIP	23313552
MIRT691196	hsa-miR-6754-5p	HITS-CLIP	23313552
MIRT691195	hsa-miR-1247-3p	HITS-CLIP	23313552
MIRT691194	hsa-miR-1827	HITS-CLIP	23313552
MIRT691193	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT691192	hsa-miR-6086	HITS-CLIP	23313552
MIRT691191	hsa-miR-2467-3p	HITS-CLIP	23313552
MIRT691190	hsa-miR-6132	HITS-CLIP	23313552
MIRT691189	hsa-miR-6836-5p	HITS-CLIP	23313552
MIRT691188	hsa-miR-1909-3p	HITS-CLIP	23313552
MIRT691187	hsa-miR-6722-3p	HITS-CLIP	23313552
MIRT691186	hsa-miR-3612	HITS-CLIP	23313552
MIRT691185	hsa-miR-650	HITS-CLIP	23313552
MIRT691184	hsa-miR-4300	HITS-CLIP	23313552
MIRT691183	hsa-miR-5591-5p	HITS-CLIP	23313552
MIRT691182	hsa-miR-6726-5p	HITS-CLIP	23313552
MIRT691181	hsa-miR-920	HITS-CLIP	23313552
MIRT691180	hsa-miR-6511b-5p	HITS-CLIP	23313552
MIRT691179	hsa-miR-6811-5p	HITS-CLIP	23313552
MIRT691201	hsa-miR-1910-3p	HITS-CLIP	23313552
MIRT691200	hsa-miR-6511a-5p	HITS-CLIP	23313552
MIRT691199	hsa-miR-4257	HITS-CLIP	23313552
MIRT691198	hsa-miR-4270	HITS-CLIP	23313552
MIRT691197	hsa-miR-4441	HITS-CLIP	23313552
MIRT691196	hsa-miR-6754-5p	HITS-CLIP	23313552
MIRT691195	hsa-miR-1247-3p	HITS-CLIP	23313552
MIRT691194	hsa-miR-1827	HITS-CLIP	23313552
MIRT691193	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT691192	hsa-miR-6086	HITS-CLIP	23313552
MIRT691191	hsa-miR-2467-3p	HITS-CLIP	23313552
MIRT691190	hsa-miR-6132	HITS-CLIP	23313552
MIRT691189	hsa-miR-6836-5p	HITS-CLIP	23313552
MIRT691188	hsa-miR-1909-3p	HITS-CLIP	23313552
MIRT691187	hsa-miR-6722-3p	HITS-CLIP	23313552
MIRT691186	hsa-miR-3612	HITS-CLIP	23313552
MIRT691185	hsa-miR-650	HITS-CLIP	23313552
MIRT691184	hsa-miR-4300	HITS-CLIP	23313552
MIRT691183	hsa-miR-5591-5p	HITS-CLIP	23313552
MIRT691182	hsa-miR-6726-5p	HITS-CLIP	23313552
MIRT691181	hsa-miR-920	HITS-CLIP	23313552
MIRT691180	hsa-miR-6511b-5p	HITS-CLIP	23313552
MIRT691179	hsa-miR-6811-5p	HITS-CLIP	23313552
MIRT1184855	hsa-miR-4328	CLIP-seq
MIRT1184856	hsa-miR-4724-3p	CLIP-seq
MIRT1184857	hsa-miR-4773	CLIP-seq
MIRT1184858	hsa-miR-582-5p	CLIP-seq
MIRT1184859	hsa-miR-656	CLIP-seq
MIRT1184860	hsa-miR-3124-3p	CLIP-seq
MIRT1184861	hsa-miR-3685	CLIP-seq
MIRT1184862	hsa-miR-374a	CLIP-seq
MIRT1184863	hsa-miR-374b	CLIP-seq
MIRT1184864	hsa-miR-384	CLIP-seq
MIRT1184865	hsa-miR-4517	CLIP-seq
MIRT1184858	hsa-miR-582-5p	CLIP-seq
MIRT1184859	hsa-miR-656	CLIP-seq
MIRT1184866	hsa-miR-889	CLIP-seq
MIRT2282808	hsa-miR-3156-3p	CLIP-seq
MIRT2282809	hsa-miR-345	CLIP-seq
MIRT2282810	hsa-miR-4301	CLIP-seq
MIRT2580929	hsa-miR-3152-3p	CLIP-seq
MIRT2580930	hsa-miR-3674	CLIP-seq
MIRT2580931	hsa-miR-382	CLIP-seq
MIRT2580932	hsa-miR-4267	CLIP-seq
MIRT2580933	hsa-miR-4642	CLIP-seq
MIRT2580934	hsa-miR-4715-5p	CLIP-seq
MIRT2580935	hsa-miR-520d-5p	CLIP-seq
MIRT2580936	hsa-miR-524-5p	CLIP-seq
MIRT2580929	hsa-miR-3152-3p	CLIP-seq
MIRT2580930	hsa-miR-3674	CLIP-seq
MIRT2580931	hsa-miR-382	CLIP-seq
MIRT2580932	hsa-miR-4267	CLIP-seq
MIRT2580933	hsa-miR-4642	CLIP-seq
MIRT2580934	hsa-miR-4715-5p	CLIP-seq
MIRT2580935	hsa-miR-520d-5p	CLIP-seq
MIRT2580936	hsa-miR-524-5p	CLIP-seq

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0005515	Function	Protein binding	IPI	12951069, 16189514, 19060904, 21516116, 22458338, 25416956, 25910212, 31515488, 32296183, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12951069, 15163635
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030182	Process	Neuron differentiation	ISS
GO:0042802	Function	Identical protein binding	IPI	12951069, 16189514, 25416956, 31515488
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	15163635
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	15163635

MIM	HGNC	e!Ensembl
605778	13390	ENSG00000196290

Q9GZT8

Protein name

NIF3-like protein 1 (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 1 protein)

Protein function

May function as a transcriptional corepressor through its interaction with COPS2, negatively regulating the expression of genes involved in neuronal differentiation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01784	NIF3	32 → 364	NIF3 (NGG1p interacting factor 3)	Family

Sequence

MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSP
PHTVNTLFLTNDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENR
VGIYSPHTAYDAAPQGVNNWLAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLD
KVMSAVKGIDGVSVTSFSARTGNEEQTRINLNCTQKALMQVVDFLSRNKQLYQKTEILSL
EKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRLALGVGRTLESQVKVVALCAG
SGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDLRDMLDSHLEN
KINIILSETDRDPLQVV

Sequence length

377

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Lung cancer	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (29)
AMYOTROPHIC LATERAL SCLEROSIS 2, JUVENILE (disorder)	Amyotrophic lateral sclerosis	BEFREE	11161814	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14707037, 21969008	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12672181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	14707037, 21969008	★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	15909293	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	15909293	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	15698596	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	15698596	★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	BEFREE	9667588	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19528375	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19528375	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	25369080	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia Disorders	Dystonia	BEFREE	10987649, 9328244, 9667588, 9749603, 9921872	★★★★★ ★☆☆☆☆ Found in Text Mining only
Early onset torsion dystonia	Dystonia	BEFREE	12194383	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29409010	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29409010	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphenylalaninaemia	Hyperphenylalaninemia	BEFREE	18276179, 29520738, 9921872	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphenylalaninemia, BH4-Deficient, B	Hyperphenylalaninemia	BEFREE	10582612, 30742839, 7730309	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	8204666	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30742839	★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	12889082	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29409010	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11701761	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10945765, 12451130, 17982884, 9592104	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	8880688	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonism, Juvenile	Parkinsonian disease	BEFREE	7644124	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phenylketonuria II	Phenylketonuria	BEFREE	28801146	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	12208136	★★★★★ ★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	16643317	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Genes Genes most often co-reported with NIF3L1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for NIF3L1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to NIF3L1 (see Related Genes above), that are NOT already directly curated for NIF3L1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to NIF3L1.

NIF3L1 (NGG1 interacting factor 3 like 1)

Bookmark This Gene