NICOL1 (NELL2 interacting cell ontogeny regulator 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 401115
Gene name NELL2 interacting cell ontogeny regulator 1
Gene symbol NICOL1
Synonyms (NCBI Gene)
C4orf48CHR4_55NICOL
Chromosome 4
Chromosome location 4p16.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
15 Show/Hide all (15)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003723 Function RNA binding IEA
GO:0003730 Function MRNA 3'-UTR binding IEA
GO:0003730 Function MRNA 3'-UTR binding ISS
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
614690 34437 ENSG00000243449
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q5BLP8
Protein name NELL2-interacting cell ontogeny regulator 1 (NELL2-interacting cofactor for lumicrine signaling) (NICOL)
Protein function mRNA-binding protein which interacts with a range of target mRNAs including SERPINE1, ACTA2, CCN2 and COL4A1 and may promote extracellular matrix production. Binds to the 3'-UTR of SERPINE1 mRNA and stabilizes the mRNA, possibly by competing for
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15161 Neuropep_like 33 → 93 Family
Tissue specificity TISSUE SPECIFICITY: Detected in the brain (at protein level) (PubMed:21287218). Also expressed at low levels in the kidney, primarily in tubular epithelial cells (PubMed:38625739). {ECO:0000269|PubMed:21287218, ECO:0000269|PubMed:38625739}.
Sequence 
MAPPPACRSPMSPPPPPLLLLLLSLALLGARARAEPAGSAVPAQSRPCVDCHAFEFMQRA
LQDLRKTACSLDARTETLLLQAERRALCACWPAGH
Sequence length 95
Interactions View interactions

No strongly related genes found yet for NICOL1.

No additional diseases found yet through genes similar to NICOL1.