NHERF4 (NHERF family PDZ scaffold protein 4)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79849
• Gene name: NHERF family PDZ scaffold protein 4
• Gene symbol: NHERF4
• Synonyms (NCBI Gene): IKEPP, PDZD3, PDZK2
• Chromosome: 11
• Chromosome location: 11q23.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2456207	hsa-miR-124	CLIP-seq
MIRT2456208	hsa-miR-3714	CLIP-seq
MIRT2456209	hsa-miR-3910	CLIP-seq
MIRT2456210	hsa-miR-4639-5p	CLIP-seq
MIRT2456211	hsa-miR-506	CLIP-seq

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005515	Function	Protein binding	IPI	11950846, 15523054, 19088451, 22627094, 25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS	11950846
GO:0005886	Component	Plasma membrane	IDA	22627094
GO:0005886	Component	Plasma membrane	IEA
GO:0005903	Component	Brush border	IDA	19088451
GO:0005903	Component	Brush border	IEA
GO:0006811	Process	Monoatomic ion transport	NAS	11950846
GO:0006833	Process	Water transport	NAS	11950846
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IC	11950846
GO:0008200	Function	Ion channel inhibitor activity	TAS	11950846
GO:0009636	Process	Response to toxic substance	TAS	11950846
GO:0010754	Process	Negative regulation of cGMP-mediated signaling	IDA	11950846
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IBA
GO:0030251	Function	Guanylate cyclase inhibitor activity	IDA	11950846
GO:0043296	Component	Apical junction complex	IDA	11950846, 19088451
GO:0043495	Function	Protein-membrane adaptor activity	IBA
GO:0045177	Component	Apical part of cell	IDA	11950846, 19088451
GO:0045177	Component	Apical part of cell	IEA
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:1990381	Function	Ubiquitin-specific protease binding	IPI	26756164

Other IDs

• MIM: 607146
• HGNC: 19891
• e!Ensembl: ENSG00000172367

Protein

• UniProt ID: Q86UT5
• Protein name: Na(+)/H(+) exchange regulatory cofactor NHE-RF4 (NHERF-4) (Intestinal and kidney-enriched PDZ protein) (Natrium-phosphate cotransporter IIa C-terminal-associated protein 2) (Na/Pi cotransporter C-terminal-associated protein 2) (NaPi-Cap2) (PDZ domain-cont
• Protein function: Acts as a regulatory protein that associates with GUCY2C and negatively modulates its heat-stable enterotoxin-mediated activation (PubMed:11950846). Stimulates SLC9A3 activity in the presence of elevated calcium ions (PubMed:19088451). {ECO:0000
• PDB: 2V90
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	330 → 409	PDZ domain	Domain
  PF00595	PDZ	116 → 193	PDZ domain	Domain
  PF00595	PDZ	224 → 298	PDZ domain	Domain
  PF17820	PDZ_6	492 → 540	PDZ domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in kidney and the gastrointestinal tract. Not detected in brain, heart, skeletal muscle or cells of hematopoietic origin. {ECO:0000269|PubMed:11950846}.
• Sequence:

  MVTPSPPGNHSLSLEAPRLHTASDLLGNHSLGLPLITALVGSRDRRGRVFSPVPVPLPTN
  PTTQHPTRQKLPSTLSGHRVCQAHGEPVLGLCPLLPLFCCPPHPPDPWSLERPRFCLLSK
  EEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQGLQEGDRILAVNNDVVEHEDYAVVVRR
  IRASSPRVLLTVLARHAHDVARAQLGEDAHLCPTLGPGVRPRLCHIVKDEGGFGFSVTHG
  NQGPFWLVLSTGGAAERAGVPPGARLLEVNGVSVEKFTHNQLTRKLWQSGQQVTLLVAGP
  EVEEQCRQLGLPLAAPLAEGWALPTKPRCLHLEKGPQGFGFLLREEKGLDGRPGQFLWEV
  DPGLPAKKAGMQAGDRLVAVAGESVEGLGHEETVSRIQGQGSCVSLTVVDPEADRFFSMV
  RLSPLLFLENTEAPASPRGSSSASLVETEDPSLEDTSVPSVPLGSRQCFLYPGPGGSYGF
  RLSCVASGPRLFISQVTPGGSAARAGLQVGDVILEVNGYPVGGQNDLERLQQLPEAEPPL
  CLKLAARSLRGLEAWIPPGAAEDWALASDLL

• Sequence length: 571

Pathways

Reactome Pathway:

Intestinal infectious diseases

Related Genes

No strongly related genes found yet for NHERF4.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NHERF4.