Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	4793
Gene name	NFKB inhibitor beta
Gene symbol	NFKBIB
Synonyms (NCBI Gene)	IKBBTRIP9
Chromosome	19
Chromosome location	19q13.2
Summary	The protein encoded by this gene belongs to the NF-kappa-B inhibitor family, which inhibit NF-kappa-B by complexing with, and trapping it in the cytoplasm. Phosphorylation of serine residues on these proteins by kinases marks them for destruction via the

226

Show/Hide all (226)

miRTarBase ID	miRNA	Experiments	Reference
MIRT731837	hsa-miR-20a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26286834
MIRT731837	hsa-miR-20a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26286834
MIRT1183525	hsa-miR-1	CLIP-seq
MIRT1183526	hsa-miR-206	CLIP-seq
MIRT1183527	hsa-miR-3064-3p	CLIP-seq
MIRT1183528	hsa-miR-3121-5p	CLIP-seq
MIRT1183529	hsa-miR-3168	CLIP-seq
MIRT1183530	hsa-miR-3652	CLIP-seq
MIRT1183531	hsa-miR-3663-5p	CLIP-seq
MIRT1183532	hsa-miR-3673	CLIP-seq
MIRT1183533	hsa-miR-4252	CLIP-seq
MIRT1183534	hsa-miR-4302	CLIP-seq
MIRT1183535	hsa-miR-4430	CLIP-seq
MIRT1183536	hsa-miR-4715-3p	CLIP-seq
MIRT1183537	hsa-miR-4763-5p	CLIP-seq
MIRT1183538	hsa-miR-4776-3p	CLIP-seq
MIRT1183539	hsa-miR-515-5p	CLIP-seq
MIRT1183540	hsa-miR-613	CLIP-seq
MIRT1183525	hsa-miR-1	CLIP-seq
MIRT2053178	hsa-miR-106a	CLIP-seq
MIRT2053179	hsa-miR-106b	CLIP-seq
MIRT2053180	hsa-miR-1182	CLIP-seq
MIRT2053181	hsa-miR-1234	CLIP-seq
MIRT2053182	hsa-miR-150	CLIP-seq
MIRT2053183	hsa-miR-17	CLIP-seq
MIRT2053184	hsa-miR-193a-5p	CLIP-seq
MIRT1183526	hsa-miR-206	CLIP-seq
MIRT2053185	hsa-miR-20a	CLIP-seq
MIRT2053186	hsa-miR-20b	CLIP-seq
MIRT2053187	hsa-miR-302a	CLIP-seq
MIRT2053188	hsa-miR-302b	CLIP-seq
MIRT2053189	hsa-miR-302c	CLIP-seq
MIRT2053190	hsa-miR-302d	CLIP-seq
MIRT2053191	hsa-miR-302e	CLIP-seq
MIRT1183527	hsa-miR-3064-3p	CLIP-seq
MIRT1183528	hsa-miR-3121-5p	CLIP-seq
MIRT1183529	hsa-miR-3168	CLIP-seq
MIRT2053192	hsa-miR-3187-3p	CLIP-seq
MIRT1183530	hsa-miR-3652	CLIP-seq
MIRT1183531	hsa-miR-3663-5p	CLIP-seq
MIRT1183532	hsa-miR-3673	CLIP-seq
MIRT2053193	hsa-miR-372	CLIP-seq
MIRT2053194	hsa-miR-373	CLIP-seq
MIRT1183533	hsa-miR-4252	CLIP-seq
MIRT2053195	hsa-miR-431	CLIP-seq
MIRT1183535	hsa-miR-4430	CLIP-seq
MIRT2053196	hsa-miR-4435	CLIP-seq
MIRT2053197	hsa-miR-4438	CLIP-seq
MIRT2053198	hsa-miR-4659a-5p	CLIP-seq
MIRT2053199	hsa-miR-4659b-5p	CLIP-seq
MIRT2053200	hsa-miR-4682	CLIP-seq
MIRT2053201	hsa-miR-4701-5p	CLIP-seq
MIRT1183536	hsa-miR-4715-3p	CLIP-seq
MIRT2053202	hsa-miR-4716-5p	CLIP-seq
MIRT2053203	hsa-miR-4731-5p	CLIP-seq
MIRT2053204	hsa-miR-4755-3p	CLIP-seq
MIRT1183537	hsa-miR-4763-5p	CLIP-seq
MIRT1183538	hsa-miR-4776-3p	CLIP-seq
MIRT2053205	hsa-miR-4781-3p	CLIP-seq
MIRT2053206	hsa-miR-498	CLIP-seq
MIRT2053207	hsa-miR-5095	CLIP-seq
MIRT2053208	hsa-miR-512-3p	CLIP-seq
MIRT1183539	hsa-miR-515-5p	CLIP-seq
MIRT2053209	hsa-miR-519d	CLIP-seq
MIRT2053210	hsa-miR-520a-3p	CLIP-seq
MIRT2053211	hsa-miR-520b	CLIP-seq
MIRT2053212	hsa-miR-520c-3p	CLIP-seq
MIRT2053213	hsa-miR-520d-3p	CLIP-seq
MIRT2053214	hsa-miR-520e	CLIP-seq
MIRT2053215	hsa-miR-520g	CLIP-seq
MIRT2053216	hsa-miR-520h	CLIP-seq
MIRT2053217	hsa-miR-548s	CLIP-seq
MIRT2053218	hsa-miR-588	CLIP-seq
MIRT1183540	hsa-miR-613	CLIP-seq
MIRT2053219	hsa-miR-614	CLIP-seq
MIRT2053220	hsa-miR-93	CLIP-seq
MIRT1183525	hsa-miR-1	CLIP-seq
MIRT2053178	hsa-miR-106a	CLIP-seq
MIRT2053179	hsa-miR-106b	CLIP-seq
MIRT2053180	hsa-miR-1182	CLIP-seq
MIRT2053181	hsa-miR-1234	CLIP-seq
MIRT2282475	hsa-miR-136	CLIP-seq
MIRT2053182	hsa-miR-150	CLIP-seq
MIRT2053183	hsa-miR-17	CLIP-seq
MIRT2282476	hsa-miR-1915	CLIP-seq
MIRT2053184	hsa-miR-193a-5p	CLIP-seq
MIRT1183526	hsa-miR-206	CLIP-seq
MIRT2053185	hsa-miR-20a	CLIP-seq
MIRT2053186	hsa-miR-20b	CLIP-seq
MIRT2053187	hsa-miR-302a	CLIP-seq
MIRT2053188	hsa-miR-302b	CLIP-seq
MIRT2053189	hsa-miR-302c	CLIP-seq
MIRT2053190	hsa-miR-302d	CLIP-seq
MIRT2053191	hsa-miR-302e	CLIP-seq
MIRT2282477	hsa-miR-3160-3p	CLIP-seq
MIRT2053192	hsa-miR-3187-3p	CLIP-seq
MIRT2282478	hsa-miR-34b	CLIP-seq
MIRT1183530	hsa-miR-3652	CLIP-seq
MIRT1183531	hsa-miR-3663-5p	CLIP-seq
MIRT1183532	hsa-miR-3673	CLIP-seq
MIRT2053193	hsa-miR-372	CLIP-seq
MIRT2053194	hsa-miR-373	CLIP-seq
MIRT2282479	hsa-miR-411	CLIP-seq
MIRT2282480	hsa-miR-4279	CLIP-seq
MIRT1183534	hsa-miR-4302	CLIP-seq
MIRT2053195	hsa-miR-431	CLIP-seq
MIRT2282481	hsa-miR-4420	CLIP-seq
MIRT1183535	hsa-miR-4430	CLIP-seq
MIRT2053196	hsa-miR-4435	CLIP-seq
MIRT2053197	hsa-miR-4438	CLIP-seq
MIRT2282482	hsa-miR-4487	CLIP-seq
MIRT2282483	hsa-miR-4488	CLIP-seq
MIRT2053198	hsa-miR-4659a-5p	CLIP-seq
MIRT2053199	hsa-miR-4659b-5p	CLIP-seq
MIRT2282484	hsa-miR-4697-5p	CLIP-seq
MIRT2053201	hsa-miR-4701-5p	CLIP-seq
MIRT2053202	hsa-miR-4716-5p	CLIP-seq
MIRT2282485	hsa-miR-4726-3p	CLIP-seq
MIRT2053203	hsa-miR-4731-5p	CLIP-seq
MIRT2053204	hsa-miR-4755-3p	CLIP-seq
MIRT1183537	hsa-miR-4763-5p	CLIP-seq
MIRT2282486	hsa-miR-4772-3p	CLIP-seq
MIRT1183538	hsa-miR-4776-3p	CLIP-seq
MIRT2282487	hsa-miR-4777-3p	CLIP-seq
MIRT2053205	hsa-miR-4781-3p	CLIP-seq
MIRT2053207	hsa-miR-5095	CLIP-seq
MIRT2053208	hsa-miR-512-3p	CLIP-seq
MIRT1183539	hsa-miR-515-5p	CLIP-seq
MIRT2053209	hsa-miR-519d	CLIP-seq
MIRT2053210	hsa-miR-520a-3p	CLIP-seq
MIRT2053211	hsa-miR-520b	CLIP-seq
MIRT2053212	hsa-miR-520c-3p	CLIP-seq
MIRT2053213	hsa-miR-520d-3p	CLIP-seq
MIRT2053214	hsa-miR-520e	CLIP-seq
MIRT2053215	hsa-miR-520g	CLIP-seq
MIRT2053216	hsa-miR-520h	CLIP-seq
MIRT2053217	hsa-miR-548s	CLIP-seq
MIRT2282488	hsa-miR-558	CLIP-seq
MIRT2282489	hsa-miR-562	CLIP-seq
MIRT2053218	hsa-miR-588	CLIP-seq
MIRT1183540	hsa-miR-613	CLIP-seq
MIRT2053219	hsa-miR-614	CLIP-seq
MIRT2282490	hsa-miR-637	CLIP-seq
MIRT2053220	hsa-miR-93	CLIP-seq
MIRT2053180	hsa-miR-1182	CLIP-seq
MIRT2053184	hsa-miR-193a-5p	CLIP-seq
MIRT2455110	hsa-miR-3149	CLIP-seq
MIRT2282479	hsa-miR-411	CLIP-seq
MIRT2455111	hsa-miR-4735-5p	CLIP-seq
MIRT2455112	hsa-miR-4775	CLIP-seq
MIRT2455113	hsa-miR-4787-3p	CLIP-seq
MIRT2455114	hsa-miR-590-3p	CLIP-seq
MIRT2053180	hsa-miR-1182	CLIP-seq
MIRT2053184	hsa-miR-193a-5p	CLIP-seq
MIRT2455110	hsa-miR-3149	CLIP-seq
MIRT2282479	hsa-miR-411	CLIP-seq
MIRT2455111	hsa-miR-4735-5p	CLIP-seq
MIRT2455112	hsa-miR-4775	CLIP-seq
MIRT2455114	hsa-miR-590-3p	CLIP-seq
MIRT2053180	hsa-miR-1182	CLIP-seq
MIRT2053181	hsa-miR-1234	CLIP-seq
MIRT2053182	hsa-miR-150	CLIP-seq
MIRT2282476	hsa-miR-1915	CLIP-seq
MIRT2053184	hsa-miR-193a-5p	CLIP-seq
MIRT2455110	hsa-miR-3149	CLIP-seq
MIRT2282479	hsa-miR-411	CLIP-seq
MIRT2282480	hsa-miR-4279	CLIP-seq
MIRT2053195	hsa-miR-431	CLIP-seq
MIRT2282485	hsa-miR-4726-3p	CLIP-seq
MIRT2455111	hsa-miR-4735-5p	CLIP-seq
MIRT1183537	hsa-miR-4763-5p	CLIP-seq
MIRT2455112	hsa-miR-4775	CLIP-seq
MIRT2282487	hsa-miR-4777-3p	CLIP-seq
MIRT2455113	hsa-miR-4787-3p	CLIP-seq
MIRT2053206	hsa-miR-498	CLIP-seq
MIRT2282489	hsa-miR-562	CLIP-seq
MIRT2455114	hsa-miR-590-3p	CLIP-seq
MIRT1183525	hsa-miR-1	CLIP-seq
MIRT2053178	hsa-miR-106a	CLIP-seq
MIRT2053179	hsa-miR-106b	CLIP-seq
MIRT2053180	hsa-miR-1182	CLIP-seq
MIRT2053181	hsa-miR-1234	CLIP-seq
MIRT2053182	hsa-miR-150	CLIP-seq
MIRT2053183	hsa-miR-17	CLIP-seq
MIRT2282476	hsa-miR-1915	CLIP-seq
MIRT2053184	hsa-miR-193a-5p	CLIP-seq
MIRT1183526	hsa-miR-206	CLIP-seq
MIRT2053185	hsa-miR-20a	CLIP-seq
MIRT2053186	hsa-miR-20b	CLIP-seq
MIRT2053187	hsa-miR-302a	CLIP-seq
MIRT2053188	hsa-miR-302b	CLIP-seq
MIRT2053189	hsa-miR-302c	CLIP-seq
MIRT2053190	hsa-miR-302d	CLIP-seq
MIRT2053191	hsa-miR-302e	CLIP-seq
MIRT2455110	hsa-miR-3149	CLIP-seq
MIRT1183530	hsa-miR-3652	CLIP-seq
MIRT1183532	hsa-miR-3673	CLIP-seq
MIRT2053193	hsa-miR-372	CLIP-seq
MIRT2053194	hsa-miR-373	CLIP-seq
MIRT2282479	hsa-miR-411	CLIP-seq
MIRT2282480	hsa-miR-4279	CLIP-seq
MIRT2053195	hsa-miR-431	CLIP-seq
MIRT1183535	hsa-miR-4430	CLIP-seq
MIRT2053197	hsa-miR-4438	CLIP-seq
MIRT2282485	hsa-miR-4726-3p	CLIP-seq
MIRT2053203	hsa-miR-4731-5p	CLIP-seq
MIRT2455111	hsa-miR-4735-5p	CLIP-seq
MIRT1183537	hsa-miR-4763-5p	CLIP-seq
MIRT2455112	hsa-miR-4775	CLIP-seq
MIRT2282487	hsa-miR-4777-3p	CLIP-seq
MIRT2455113	hsa-miR-4787-3p	CLIP-seq
MIRT2053206	hsa-miR-498	CLIP-seq
MIRT2053207	hsa-miR-5095	CLIP-seq
MIRT2053208	hsa-miR-512-3p	CLIP-seq
MIRT2053209	hsa-miR-519d	CLIP-seq
MIRT2053210	hsa-miR-520a-3p	CLIP-seq
MIRT2053211	hsa-miR-520b	CLIP-seq
MIRT2053212	hsa-miR-520c-3p	CLIP-seq
MIRT2053213	hsa-miR-520d-3p	CLIP-seq
MIRT2053214	hsa-miR-520e	CLIP-seq
MIRT2053215	hsa-miR-520g	CLIP-seq
MIRT2053216	hsa-miR-520h	CLIP-seq
MIRT2282489	hsa-miR-562	CLIP-seq
MIRT2455114	hsa-miR-590-3p	CLIP-seq
MIRT1183540	hsa-miR-613	CLIP-seq
MIRT2053220	hsa-miR-93	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SRY	Unknown	12475944

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	TAS	7776974
GO:0005515	Function	Protein binding	IPI	10498867, 14685242, 14743216, 15601829, 21988832, 24973451, 25241761, 25416956, 32296183, 32814053, 33961781, 35140242, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	TAS	7776974
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	TAS	7776974
GO:0043122	Process	Regulation of canonical NF-kappaB signal transduction	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA

MIM	HGNC	e!Ensembl
604495	7798	ENSG00000104825

Q15653

Protein name

NF-kappa-B inhibitor beta (NF-kappa-BIB) (I-kappa-B-beta) (IkB-B) (IkB-beta) (IkappaBbeta) (Thyroid receptor-interacting protein 9) (TR-interacting protein 9) (TRIP-9)

Protein function

Inhibits NF-kappa-B by complexing with and trapping it in the cytoplasm. However, the unphosphorylated form resynthesized after cell stimulation is able to bind NF-kappa-B allowing its transport to the nucleus and protecting it to further NFKBIA

PDB

9CK0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13637	Ank_4	58 → 113		Repeat
PF00023	Ank	126 → 151	Ankyrin repeat	Repeat
PF13637	Ank_4	207 → 261		Repeat

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues examined.

Sequence

MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGL
CVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALY
PDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTC
GRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGSAMLRPNPILARLLRAHGAPE
PEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPRPV

Sequence length

356

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (22)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Atherosclerosis	Atherosclerosis	Pubtator	28195197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10373501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33275223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19500386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	12743709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	20562129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	12762338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	27104832	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19500386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	31363162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	34807923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	27104832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19500386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26286834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26227166		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19500386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	20131316	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	19717478	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	20562129, 24498427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28607508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26286834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26286834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NFKBIB (NFKB inhibitor beta)