NFE4 (nuclear factor, erythroid 4) | GeDiPNet

GeDiPNet

Log in to bookmark this gene

Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	58160
Gene name	Nuclear factor, erythroid 4
Gene symbol	NFE4
Synonyms (NCBI Gene)	NF-E4
Chromosome	7
Chromosome location	7q22.1
Summary	The erythroid-specific protein encoded by this gene, and the ubiquitous transcription factor CP2, form the stage selector protein (SSP) complex, which is involved in preferential expression of the gamma-globin genes in fetal erythroid cells. Alternate use

16 Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	16263792
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IMP	15273251
GO:0003712	Function	Transcription coregulator activity	IDA	11003662
GO:0003712	Function	Transcription coregulator activity	IMP	15273251, 16263792
GO:0005515	Function	Protein binding	IPI	15273251, 16263792, 19234465
GO:0005634	Component	Nucleus	IDA	11003662
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	15084587
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	16263792
GO:0032991	Component	Protein-containing complex	IDA	11003662
GO:0032991	Component	Protein-containing complex	IMP	15273251, 16263792
GO:0042803	Function	Protein homodimerization activity	IDA	11003662
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	11003662
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	15273251
GO:0065003	Process	Protein-containing complex assembly	IDA	11003662
GO:0140297	Function	DNA-binding transcription factor binding	IPI	11003662

MIM	HGNC	e!Ensembl
612133	29902	ENSG00000230257

Protein Protein information from UniProt database. Download as csv Download as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.	Q86UQ8
Protein name	Transcription factor NF-E4
Protein function	Functions as part of the SSP (stage selector protein) complex, a complex that contributes to the preferential expression of the gamma-gene in fetal erythroid cells by facilitating the interaction of the gamma-globin genes with enhancer elements
Family and domains
Tissue specificity	TISSUE SPECIFICITY: Specifically expressed in fetal liver, cord blood and bone marrow. Also expressed in the K562 and HEL cell lines, which constitutively express the fetal globin genes. {ECO:0000269\|PubMed:11003662}.
Sequence	MPRVVCWHTLKSLNGYKNLSSGAETREGLRSSSPVDLPLRPRKQATAAGQRKLLSLQLLL CACTSVTDLTYWGPAGHGATAPHRSLLAIHLHLVPASSAAMKATGPHNAQTQVNPQGHAP SAEDPTGTWTVSGPCKDHPHPFLSQSNPPTRISSALPLKTDSALEQTPQQLPSLHLSQG
Sequence length	179
Interactions	View interactions