NEUROG2 (neurogenin 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 63973
• Gene name: Neurogenin 2
• Gene symbol: NEUROG2
• Synonyms (NCBI Gene): Atoh4, Math4A, NGN2, bHLHa8, ngn-2
• Chromosome: 4
• Chromosome location: 4q25
• Summary: This gene encodes a neural-specific basic helix-loop-helix (bHLH) transcription factor that can specify a neuronal fate on ectodermal cells and is expressed in neural progenitor cells within the developing central and peripheral nervous systems. The prote

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1181338	hsa-miR-1324	CLIP-seq
MIRT1181339	hsa-miR-188-3p	CLIP-seq
MIRT1181340	hsa-miR-3120-3p	CLIP-seq
MIRT1181341	hsa-miR-3158-5p	CLIP-seq
MIRT1181342	hsa-miR-3166	CLIP-seq
MIRT1181343	hsa-miR-3908	CLIP-seq
MIRT1181344	hsa-miR-4771	CLIP-seq
MIRT1181345	hsa-miR-596	CLIP-seq
MIRT2052498	hsa-miR-2116	CLIP-seq
MIRT2052499	hsa-miR-4273	CLIP-seq
MIRT2052500	hsa-miR-4677-5p	CLIP-seq
MIRT2052501	hsa-miR-4715-3p	CLIP-seq
MIRT2052502	hsa-miR-578	CLIP-seq
MIRT2052503	hsa-miR-659	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007423	Process	Sensory organ development	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030900	Process	Forebrain development	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	ISS
GO:0061564	Process	Axon development	IBA
GO:0070888	Function	E-box binding	IBA
GO:0070888	Function	E-box binding	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

Other IDs

• MIM: 606624
• HGNC: 13805
• e!Ensembl: ENSG00000178403

Protein

• UniProt ID: Q9H2A3
• Protein name: Neurogenin-2 (NGN-2) (Class A basic helix-loop-helix protein 8) (bHLHa8) (Protein atonal homolog 4)
• Protein function: Transcriptional regulator. Involved in neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3').
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00010	HLH	113 → 165	Helix-loop-helix DNA-binding domain	Domain

• Sequence:

  MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAG
  QGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNR
  ERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGG
  LPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSP
  ASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI

• Sequence length: 272

Related Genes

No strongly related genes found yet for NEUROG2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NEUROG2.