NENF (neudesin neurotrophic factor)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 29937
• Gene name: Neudesin neurotrophic factor
• Gene symbol: NENF
• Synonyms (NCBI Gene): CIR2, SCIRP10, SPUF
• Chromosome: 1
• Chromosome location: 1q32.3
• Summary: This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan

miRNA Show/Hide all (42)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045242	hsa-miR-186-5p	CLASH	23622248
MIRT1180543	hsa-miR-3913-3p	CLIP-seq
MIRT1180544	hsa-miR-489	CLIP-seq
MIRT2052249	hsa-miR-1286	CLIP-seq
MIRT2052250	hsa-miR-3065-3p	CLIP-seq
MIRT2052251	hsa-miR-4291	CLIP-seq
MIRT2052252	hsa-miR-4328	CLIP-seq
MIRT2052253	hsa-miR-450b-5p	CLIP-seq
MIRT2052254	hsa-miR-4676-5p	CLIP-seq
MIRT2052255	hsa-miR-4722-5p	CLIP-seq
MIRT2052256	hsa-miR-4768-3p	CLIP-seq
MIRT2052257	hsa-miR-507	CLIP-seq
MIRT2052258	hsa-miR-557	CLIP-seq
MIRT2052259	hsa-miR-575	CLIP-seq
MIRT2391482	hsa-miR-1266	CLIP-seq
MIRT2391483	hsa-miR-1293	CLIP-seq
MIRT2391484	hsa-miR-24	CLIP-seq
MIRT2391485	hsa-miR-3127-5p	CLIP-seq
MIRT2391486	hsa-miR-3918	CLIP-seq
MIRT2391487	hsa-miR-4284	CLIP-seq
MIRT2052252	hsa-miR-4328	CLIP-seq
MIRT2391488	hsa-miR-4483	CLIP-seq
MIRT2391489	hsa-miR-4512	CLIP-seq
MIRT2391490	hsa-miR-4514	CLIP-seq
MIRT2391491	hsa-miR-4518	CLIP-seq
MIRT2391492	hsa-miR-4645-5p	CLIP-seq
MIRT2391493	hsa-miR-4673	CLIP-seq
MIRT2052254	hsa-miR-4676-5p	CLIP-seq
MIRT2391494	hsa-miR-4692	CLIP-seq
MIRT2052259	hsa-miR-575	CLIP-seq
MIRT2579881	hsa-miR-2355-5p	CLIP-seq
MIRT2579882	hsa-miR-3529	CLIP-seq
MIRT2579883	hsa-miR-379	CLIP-seq
MIRT2579884	hsa-miR-3927	CLIP-seq
MIRT2579885	hsa-miR-4726-3p	CLIP-seq
MIRT2579886	hsa-miR-615-5p	CLIP-seq
MIRT2579881	hsa-miR-2355-5p	CLIP-seq
MIRT2579882	hsa-miR-3529	CLIP-seq
MIRT2579883	hsa-miR-379	CLIP-seq
MIRT2579884	hsa-miR-3927	CLIP-seq
MIRT2579885	hsa-miR-4726-3p	CLIP-seq
MIRT2579886	hsa-miR-615-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0005515	Function	Protein binding	IPI	31536960
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	31536960
GO:0005615	Component	Extracellular space	IEA
GO:0005739	Component	Mitochondrion	IDA	31536960
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	31536960
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0012505	Component	Endomembrane system	IBA
GO:0016020	Component	Membrane	IBA
GO:0032099	Process	Negative regulation of appetite	IEA
GO:0032099	Process	Negative regulation of appetite	ISS
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 611874
• HGNC: 30384
• e!Ensembl: ENSG00000117691

Protein

• UniProt ID: Q9UMX5
• Protein name: Neudesin (Cell immortalization-related protein 2) (Neuron-derived neurotrophic factor) (Protein GIG47) (Secreted protein of unknown function) (SPUF protein)
• Protein function: Acts as a neurotrophic factor in postnatal mature neurons enhancing neuronal survival (PubMed:31536960). Promotes cell proliferation and neurogenesis in undifferentiated neural progenitor cells at the embryonic stage and inhibits differentiation
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00173	Cyt-b5	48 → 144	Cytochrome b5-like Heme/Steroid binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed with high expression in heart. Over-expressed in various tumors including carcinomas of the uterine cervix, lymphoma, colon, lung, skin and leukemia, as well as carcinoma of the breast. {ECO:0000269|PubMed:227481
• Sequence:

  MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEE
  DQPIYLAVKGVVFDVTSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAK
  ELEALDEVFTKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF

• Sequence length: 172

Related Genes

No strongly related genes found yet for NENF.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NENF.