NEK3 (NIMA related kinase 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4752
• Gene name: NIMA related kinase 3
• Gene symbol: NEK3
• Synonyms (NCBI Gene): HSPK36
• Chromosome: 13
• Chromosome location: 13q14.3
• Summary: This gene encodes a member of the NimA (never in mitosis A) family of serine/threonine protein kinases. The encoded protein differs from other NimA family members in that it is not cell cycle regulated and is found primarily in the cytoplasm. The kinase i

miRNA Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027849	hsa-miR-98-5p	Microarray	19088304
MIRT047278	hsa-miR-181b-5p	CLASH	23622248
MIRT1180119	hsa-miR-142-5p	CLIP-seq
MIRT1180120	hsa-miR-324-5p	CLIP-seq
MIRT1180121	hsa-miR-340	CLIP-seq
MIRT1180122	hsa-miR-4310	CLIP-seq
MIRT1180123	hsa-miR-548m	CLIP-seq
MIRT1180124	hsa-miR-1288	CLIP-seq
MIRT1180125	hsa-miR-3199	CLIP-seq
MIRT1180126	hsa-miR-4652-3p	CLIP-seq
MIRT1180127	hsa-miR-4795-3p	CLIP-seq
MIRT1180128	hsa-miR-518a-5p	CLIP-seq
MIRT1180129	hsa-miR-527	CLIP-seq
MIRT1180130	hsa-miR-579	CLIP-seq
MIRT1180131	hsa-miR-584	CLIP-seq
MIRT1180132	hsa-let-7a	CLIP-seq
MIRT1180133	hsa-let-7b	CLIP-seq
MIRT1180134	hsa-let-7c	CLIP-seq
MIRT1180135	hsa-let-7d	CLIP-seq
MIRT1180136	hsa-let-7e	CLIP-seq
MIRT1180137	hsa-let-7f	CLIP-seq
MIRT1180138	hsa-let-7g	CLIP-seq
MIRT1180139	hsa-let-7i	CLIP-seq
MIRT1180140	hsa-miR-202	CLIP-seq
MIRT1180120	hsa-miR-324-5p	CLIP-seq
MIRT1180141	hsa-miR-3921	CLIP-seq
MIRT1180122	hsa-miR-4310	CLIP-seq
MIRT1180142	hsa-miR-4458	CLIP-seq
MIRT1180143	hsa-miR-4500	CLIP-seq
MIRT1180144	hsa-miR-4649-3p	CLIP-seq
MIRT1180145	hsa-miR-4653-5p	CLIP-seq
MIRT1180127	hsa-miR-4795-3p	CLIP-seq
MIRT1180146	hsa-miR-642a	CLIP-seq
MIRT1180147	hsa-miR-98	CLIP-seq
MIRT2686156	hsa-miR-3144-3p	CLIP-seq
MIRT2686157	hsa-miR-3168	CLIP-seq
MIRT2686158	hsa-miR-3613-3p	CLIP-seq
MIRT2686159	hsa-miR-4287	CLIP-seq
MIRT2686160	hsa-miR-4305	CLIP-seq
MIRT2686161	hsa-miR-4433	CLIP-seq
MIRT2686162	hsa-miR-4436b-5p	CLIP-seq
MIRT2686163	hsa-miR-4469	CLIP-seq
MIRT2686164	hsa-miR-4685-3p	CLIP-seq
MIRT2686165	hsa-miR-4700-3p	CLIP-seq
MIRT2686166	hsa-miR-4713-5p	CLIP-seq
MIRT2686167	hsa-miR-4724-3p	CLIP-seq
MIRT2686168	hsa-miR-4777-5p	CLIP-seq
MIRT2686169	hsa-miR-4780	CLIP-seq
MIRT2686170	hsa-miR-4798-3p	CLIP-seq
MIRT2686171	hsa-miR-5095	CLIP-seq
MIRT2686172	hsa-miR-518d-5p	CLIP-seq
MIRT2686173	hsa-miR-519b-5p	CLIP-seq
MIRT2686174	hsa-miR-519c-5p	CLIP-seq
MIRT2686175	hsa-miR-520c-5p	CLIP-seq
MIRT2686176	hsa-miR-526a	CLIP-seq
MIRT2686177	hsa-miR-548ae	CLIP-seq
MIRT2686178	hsa-miR-548aj	CLIP-seq
MIRT2686179	hsa-miR-548am	CLIP-seq
MIRT2686180	hsa-miR-548x	CLIP-seq
MIRT2686181	hsa-miR-600	CLIP-seq
MIRT2686182	hsa-miR-623	CLIP-seq
MIRT2686183	hsa-miR-875-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000278	Process	Mitotic cell cycle	NAS	7522034
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	7522034
GO:0005515	Function	Protein binding	IPI	15618286
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	NAS	7522034
GO:0005737	Component	Cytoplasm	IEA
GO:0006468	Process	Protein phosphorylation	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030424	Component	Axon	IEA
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 604044
• HGNC: 7746
• e!Ensembl: ENSG00000136098

Protein

• UniProt ID: P51956
• Protein name: Serine/threonine-protein kinase Nek3 (EC 2.7.11.1) (HSPK 36) (Never in mitosis A-related kinase 3) (NimA-related protein kinase 3)
• Protein function: Protein kinase which influences neuronal morphogenesis and polarity through effects on microtubules. Regulates microtubule acetylation in neurons. Contributes to prolactin-mediated phosphorylation of PXN and VAV2. Implicated in prolactin-mediate
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	4 → 256	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Up-regulated in malignant versus normal breast tissue. Isoform 2 shows a high level of expression in testis, ovary and brain. {ECO:0000269|PubMed:12063396, ECO:0000269|PubMed:17297458}.
• Sequence:

  MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHP
  NIVAFKESFEAEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHK
  KRVLHRDIKSKNIFLTQNGKVKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYN
  NKSDIWSLGCILYELCTLKHPFQANSWKNLILKVCQGCISPLPSHYSYELQFLVKQMFKR
  NPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRI
  ALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHLRKASSPNLHR
  RQWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILK
  NADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTD
  FEEEDDNPDWVSELKKRAGWQGLCDR

• Sequence length: 506

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Hereditary breast ovarian cancer syndrome	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	-	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	-	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (12)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	15618286, 17297458, 27489110, 29504992, 31741759		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18246042	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27489110, 29504992	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29504992	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15618286, 17297458, 27489110, 29504992, 31741759		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17118778		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29504992		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29504992		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17118778		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29504992		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29504992	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31906878	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for NEK3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NEK3.