NECTIN4 (nectin cell adhesion molecule 4)

Gene

• Entrez ID: 81607
• Gene name: Nectin cell adhesion molecule 4
• Gene symbol: NECTIN4
• Synonyms (NCBI Gene): EDSS1, LNIR, PRR4, PVRL4, nectin-4
• Chromosome: 1
• Chromosome location: 1q23.3
• Summary: This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs1537044	G>A,C	Conflicting-interpretations-of-pathogenicity, not-provided	3 prime UTR variant, coding sequence variant, missense variant
rs267606991	C>T	Pathogenic	Missense variant, coding sequence variant
rs267606992	G>A	Pathogenic	Missense variant, coding sequence variant
rs387907014	G>C	Pathogenic	Coding sequence variant, missense variant
rs730880260	A>-	Pathogenic	Coding sequence variant, frameshift variant
rs1085307124	C>T	Pathogenic	Missense variant, coding sequence variant
rs1085307125	G>A	Pathogenic	Stop gained, coding sequence variant
rs1571153052	G>A	Pathogenic	Coding sequence variant, stop gained

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT614826	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT614825	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT614824	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT614823	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT614822	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT614821	hsa-miR-4775	HITS-CLIP	23824327
MIRT614820	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT614819	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT614818	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT614817	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT614826	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT614825	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT614824	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT614823	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT614822	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT614821	hsa-miR-4775	HITS-CLIP	23824327
MIRT614820	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT614819	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT614818	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT614817	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT614826	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT614825	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT614824	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT614823	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT614822	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT614821	hsa-miR-4775	HITS-CLIP	23824327
MIRT614820	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT614819	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT614818	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT614817	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT614826	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT614825	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT614824	hsa-miR-1236-3p	HITS-CLIP	23824327
MIRT614823	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT614822	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT614821	hsa-miR-4775	HITS-CLIP	23824327
MIRT614820	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT614819	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT614818	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT614817	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT731898	hsa-miR-31-3p	Luciferase reporter assay, Western blot	27507538
MIRT731898	hsa-miR-31-3p	Luciferase reporter assay, Western blot	27507538
MIRT731899	hsa-miR-128-3p	Luciferase reporter assay, Western blot	27507538

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	21982860, 22048310, 22902367, 23202587, 28514442, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	32503945
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IBA
GO:0005912	Component	Adherens junction	IDA	25468996
GO:0005912	Component	Adherens junction	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	22902367
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	23154388
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	32503945
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048018	Function	Receptor ligand activity	IDA	32503945
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070161	Component	Anchoring junction	IEA
GO:0098631	Function	Cell adhesion mediator activity	IBA

Other IDs

• MIM: 609607
• HGNC: 19688
• e!Ensembl: ENSG00000143217

Protein

• UniProt ID: Q96NY8
• Protein name: Nectin-4 (Ig superfamily receptor LNIR) (Nectin cell adhesion molecule 4) (Poliovirus receptor-related protein 4) [Cleaved into: Processed poliovirus receptor-related protein 4]
• Protein function: Seems to be involved in cell adhesion through trans-homophilic and -heterophilic interactions, the latter including specifically interactions with NECTIN1. Does not act as receptor for alpha-herpesvirus entry into cells.; (Microbial in
• PDB: 4FRW, 4GJT, 4JJH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	35 → 146	Immunoglobulin V-set domain	Domain
  PF08205	C2-set_2	151 → 234	CD80-like C2-set immunoglobulin domain	Domain
  PF13927	Ig_3	256 → 319		Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in placenta. Not detected in normal breast epithelium but expressed in breast carcinoma. {ECO:0000269|PubMed:11544254, ECO:0000269|PubMed:17474988}.
• Sequence:

  MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGE
  QVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQA
  DEGEYECRVSTFPAGSFQARLRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPS
  VTWDTEVKGTTSSRSFKHSRSAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHIL
  HVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTL
  GFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASVVVVGVIAALL
  FCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRA
  EGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQ
  AMNHFVQENGTLRAKPTGNGIYINGRGHLV

• Sequence length: 510

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Ectodermal dysplasia-syndactyly syndrome 1	Pathogenic	rs267606991, rs267606992, rs730880260, rs387907014, rs1085307124, rs1085307125, rs1571153052, rs1653335301	RCV000001667 RCV000001668 RCV000001669 RCV000023779 RCV000488417 RCV000488420 RCV000995848 RCV001291629	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECTODERMAL DYSPLASIA SYNDACTYLY SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECTODERMAL DYSPLASIA-PILI TORTI-CUTANEOUS SYNDACTYLY SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECTODERMAL DYSPLASIA-SYNDACTYLY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECTIN4-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19679554, 24892636		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28634245		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15784625, 22717740, 23682311, 27507538, 27998973, 28232483, 28250131, 28600142, 30056265, 31572728		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17474988, 21526486, 24386110, 31617074, 35614462, 38063270	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	37480387	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	17474988	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28634245		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19679554, 20338946, 31440821		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	38043528	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37344281, 38003302	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28038455, 28232483		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	37829154	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26122960, 28250131		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	31617074	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31423176		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36104170, 36759721, 37958883	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous finger syndactyly	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dental Enamel Hypoplasia	Dental Enamel Hypoplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36175575	Stimulate	★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	23272196		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	27436115, 37876509	Associate	★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	31640787	Associate	★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	30217189		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	BEFREE	21346770, 24577405, 29430627		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ectodermal dysplasia-syndactyly syndrome	Ectodermal dysplasia skin fragility syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECTODERMAL DYSPLASIA-SYNDACTYLY SYNDROME 1	Ectodermal Dysplasia Syndactyly Syndrome	UNIPROT_DG	20691405		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ECTODERMAL DYSPLASIA-SYNDACTYLY SYNDROME 1	Ectodermal Dysplasia Syndactyly Syndrome	GENOMICS_ENGLAND_DG	20691405		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ECTODERMAL DYSPLASIA-SYNDACTYLY SYNDROME 1	Ectodermal Dysplasia Syndactyly Syndrome	ORPHANET_DG	20691405, 21346770		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ECTODERMAL DYSPLASIA-SYNDACTYLY SYNDROME 1	Ectodermal Dysplasia Syndactyly Syndrome	BEFREE	21346770, 25529316, 29265343		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ECTODERMAL DYSPLASIA-SYNDACTYLY SYNDROME 1	Ectodermal Dysplasia Syndactyly Syndrome	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ECTODERMAL DYSPLASIA-SYNDACTYLY SYNDROME 1	Ectodermal Dysplasia Syndactyly Syndrome	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Endometriosis	Endometriosis	BEFREE	22926846		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31043861		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31043861		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31883369	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27507538		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27507538		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	35256687	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	31617074	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	38063270	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	36175575	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	36175575	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26617807	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31617074, 32751328	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37480387	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15784625, 22717740, 23682311, 27507538, 27998973, 28232483, 28250131, 28600142, 30056265, 31572728		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31043861		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19679554, 20338946, 31440821		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28038455, 28232483		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25888293		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29208564, 29805618		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28634245		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22048310, 23682311, 24892636, 29805618, 31444589, 31617074		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26122960, 28250131		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15784625, 27507538, 28600142		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15784625		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	33478111, 36553569	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	35484425	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24892636, 25398436, 25690753, 25888293, 27507538, 28232483, 28778498, 29805618, 31043861, 31114323, 31617074		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	36175575	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19679554, 25157763, 26317644		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28038455, 28232483		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20959669	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28038455, 28232483	Associate	★☆☆☆☆ Found in Text Mining only
Palmar hyperkeratosis	Palmar hyperkeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25888293		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25888293	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31114323, 31819636		★☆☆☆☆ Found in Text Mining only
Peg-shaped teeth	Peg-Shaped Teeth	HPO_DG			★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	38003302	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36175575	Associate	★☆☆☆☆ Found in Text Mining only
Pseudotumor Cerebri	intracranial hypertension	GWASCAT_DG	29608535		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	32751328	Associate	★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	37480387	Associate	★☆☆☆☆ Found in Text Mining only
Simple syndactyly of toes, first web space	Syndactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19679554		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	36268557	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29208564, 29805618		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	31617074	Associate	★☆☆☆☆ Found in Text Mining only
Syndactyly	Syndactyly	BEFREE	24577405, 29430627		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32489258	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27998973, 31572728		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35614462	Stimulate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	31617074	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33901032, 34108177, 36268557, 36749325, 38063270, 39801278	Associate	★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	35164713	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	30844889		★☆☆☆☆ Found in Text Mining only