NCOR1P1 (NCOR1 pseudogene 1)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 149934 |
| Gene name | NCOR1 pseudogene 1 |
| Gene symbol | NCOR1P1 |
| Synonyms (NCBI Gene) |
C20orf191bB329D4.2
|
| Chromosome | 20 |
| Chromosome location | 20p11.1 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q9H4R4 | ||||||||||
| Protein name | Putative nuclear receptor corepressor 1-like protein NCOR1P1 (Nuclear receptor corepressor 1 pseudogene 1) | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MSSSGYPPNQGAFSTEQSHYPPHSVKYTFPSTHHQQDPAFGGKHEAPSSPILGQPCGDDQ |
||||||||||
| Sequence length | 102 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with NCOR1P1 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to NCOR1P1 (see Related Genes above), that are NOT already directly curated for NCOR1P1 itself -- a lead worth checking, not a confirmed association.
0
|
|