Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	654817
Gene name	Neutrophil cytosolic factor 1C (pseudogene)
Gene symbol	NCF1C
Synonyms (NCBI Gene)	SH3PXD1C
Chromosome	7
Chromosome location	7q11.23
Summary	The neutrophil cytosolic factor 1 (NCF1) gene encodes the 47 kDa cytosolic subunit of neutrophil NADPH oxidase, which produces superoxide anion. The NCF1 gene is located in close proximity to two highly similar, multi-exon pseudogenes at chromosome 7q11.2

10 Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0016020	Component	Membrane	IEA
GO:0016176	Function	Superoxide-generating NADPH oxidase activator activity	IBA
GO:0016176	Function	Superoxide-generating NADPH oxidase activator activity	IEA
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0042554	Process	Superoxide anion generation	IBA
GO:0043020	Component	NADPH oxidase complex	IBA
GO:0045730	Process	Respiratory burst	IBA
GO:0072593	Process	Reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

A8MVU1

Protein name

Putative neutrophil cytosol factor 1C (NCF-1C) (Putative SH3 and PX domain-containing protein 1C)

Protein function

May be required for activation of the latent NADPH oxidase (necessary for superoxide production).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00018	SH3_1	138 → 183	SH3 domain	Domain
PF00018	SH3_1	208 → 253	SH3 domain	Domain
PF00787	PX	6 → 97	PX domain	Domain
PF08944	p47_phox_C	334 → 366	NADPH oxidase subunit p47Phox, C terminal domain	Disordered
PF16621	NECFESHC	258 → 306	SH3 terminal domain of 2nd SH3 on Neutrophil cytosol factor 1	Disordered

Sequence

MYMFLVKWQDLSEKVVYRRFTEIYEFHKTLKEMFPIEAGAINPENRIIPHLPAPKWFDGQ
RAAENHQGTLTEYCSTLMSLPTKISRCPHLLDFFKVRPDDLKLPTDNQTKKPETYLMPKD
GKSTATDITGPIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGW
IPASFLEPLDSPDETEDPEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVIHKLLDGWW
VIRKDDVTGYFPSMYLQKSGQDVSQAQRQIKRGAPPRRSSIRNAHSIHQRSRKRLSQDAY
RRNSVRFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCSESTKR
KLASAV

Sequence length

366

Interactions

View interactions

Related Genes Genes most often co-reported with NCF1C across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for NCF1C.

Diseases Linked via Similar Genes Diseases curated for genes most similar to NCF1C (see Related Genes above), that are NOT already directly curated for NCF1C itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to NCF1C.

NCF1C (neutrophil cytosolic factor 1C (pseudogene))

Save This Analysis