NCBP2AS2 (NCBP2 antisense 2 (head to head))
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 152217 |
| Gene name | NCBP2 antisense 2 (head to head) |
| Gene symbol | NCBP2AS2 |
| Synonyms (NCBI Gene) |
HIARKRASIMNCBP2-AS2
|
| Chromosome | 3 |
| Chromosome location | 3q29 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
|
||||||||||||||||
|
||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
Q69YL0 |
| Protein name | Protein NCBP2AS2 (Hypoxia-induced angiogenesis regulator) (NCBP2 antisense gene protein 2) |
| Family and domains | |
| Sequence |
MVLRRLLAALLHSPQLVERLSESRPIRRAAQLTAFALLQAQLRGQDAARRLQDLAAGPVG |
| Sequence length | 99 |
| Interactions | View interactions |
|
Related Genes
Genes most often co-reported with NCBP2AS2 across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to NCBP2AS2 (see Related Genes above), that are NOT already directly curated for NCBP2AS2 itself -- a lead worth checking, not a confirmed association.
0
|
|