NCAN (neurocan)

Gene

• Entrez ID: 1463
• Gene name: Neurocan
• Gene symbol: NCAN
• Synonyms (NCBI Gene): CSPG3
• Chromosome: 19
• Chromosome location: 19p13.11
• Summary: Neurocan is a chondroitin sulfate proteoglycan thought to be involved in the modulation of cell adhesion and migration.[supplied by OMIM, Jul 2002]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT043672	hsa-miR-342-3p	CLASH	23622248
MIRT724671	hsa-miR-6165	HITS-CLIP	19536157
MIRT724670	hsa-miR-214-3p	HITS-CLIP	19536157
MIRT724669	hsa-miR-3619-5p	HITS-CLIP	19536157
MIRT724668	hsa-miR-761	HITS-CLIP	19536157
MIRT724667	hsa-miR-4530	HITS-CLIP	19536157
MIRT724666	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT724665	hsa-miR-1286	HITS-CLIP	19536157
MIRT724664	hsa-miR-711	HITS-CLIP	19536157
MIRT724663	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT570234	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT570233	hsa-miR-8068	PAR-CLIP	20371350
MIRT570232	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT570231	hsa-miR-147a	PAR-CLIP	20371350
MIRT570230	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT570229	hsa-miR-4455	PAR-CLIP	20371350
MIRT570228	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT731610	hsa-miR-24-3p	Luciferase reporter assay, qRT-PCR, Western blot	27349868
MIRT731610	hsa-miR-24-3p	Luciferase reporter assay, qRT-PCR, Western blot	27349868
MIRT724671	hsa-miR-6165	HITS-CLIP	19536157
MIRT724670	hsa-miR-214-3p	HITS-CLIP	19536157
MIRT724669	hsa-miR-3619-5p	HITS-CLIP	19536157
MIRT724668	hsa-miR-761	HITS-CLIP	19536157
MIRT724667	hsa-miR-4530	HITS-CLIP	19536157
MIRT724666	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT724665	hsa-miR-1286	HITS-CLIP	19536157
MIRT724664	hsa-miR-711	HITS-CLIP	19536157
MIRT724663	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT570234	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT570233	hsa-miR-8068	PAR-CLIP	20371350
MIRT570232	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT570231	hsa-miR-147a	PAR-CLIP	20371350
MIRT570230	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT570229	hsa-miR-4455	PAR-CLIP	20371350
MIRT570228	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT1175714	hsa-miR-125a-5p	CLIP-seq
MIRT1175715	hsa-miR-125b	CLIP-seq
MIRT1175716	hsa-miR-1264	CLIP-seq
MIRT1175717	hsa-miR-1273f	CLIP-seq
MIRT1175718	hsa-miR-1290	CLIP-seq
MIRT1175719	hsa-miR-1343	CLIP-seq
MIRT1175720	hsa-miR-147	CLIP-seq
MIRT1175721	hsa-miR-183	CLIP-seq
MIRT1175722	hsa-miR-2113	CLIP-seq
MIRT1175723	hsa-miR-297	CLIP-seq
MIRT1175724	hsa-miR-3149	CLIP-seq
MIRT1175725	hsa-miR-3166	CLIP-seq
MIRT1175726	hsa-miR-3167	CLIP-seq
MIRT1175727	hsa-miR-3169	CLIP-seq
MIRT1175728	hsa-miR-3647-3p	CLIP-seq
MIRT1175729	hsa-miR-3685	CLIP-seq
MIRT1175730	hsa-miR-3690	CLIP-seq
MIRT1175731	hsa-miR-376c	CLIP-seq
MIRT1175732	hsa-miR-378g	CLIP-seq
MIRT1175733	hsa-miR-380	CLIP-seq
MIRT1175734	hsa-miR-384	CLIP-seq
MIRT1175735	hsa-miR-4254	CLIP-seq
MIRT1175736	hsa-miR-4271	CLIP-seq
MIRT1175737	hsa-miR-4282	CLIP-seq
MIRT1175738	hsa-miR-4287	CLIP-seq
MIRT1175739	hsa-miR-4319	CLIP-seq
MIRT1175740	hsa-miR-4324	CLIP-seq
MIRT1175741	hsa-miR-4469	CLIP-seq
MIRT1175742	hsa-miR-4495	CLIP-seq
MIRT1175743	hsa-miR-4504	CLIP-seq
MIRT1175744	hsa-miR-4515	CLIP-seq
MIRT1175745	hsa-miR-4534	CLIP-seq
MIRT1175746	hsa-miR-455-5p	CLIP-seq
MIRT1175747	hsa-miR-4685-3p	CLIP-seq
MIRT1175748	hsa-miR-4685-5p	CLIP-seq
MIRT1175749	hsa-miR-4716-3p	CLIP-seq
MIRT1175750	hsa-miR-4725-3p	CLIP-seq
MIRT1175751	hsa-miR-4732-3p	CLIP-seq
MIRT1175752	hsa-miR-4778-3p	CLIP-seq
MIRT1175753	hsa-miR-4802-5p	CLIP-seq
MIRT1175754	hsa-miR-508-3p	CLIP-seq
MIRT1175755	hsa-miR-542-3p	CLIP-seq
MIRT1175756	hsa-miR-567	CLIP-seq
MIRT1175757	hsa-miR-599	CLIP-seq
MIRT1175758	hsa-miR-625	CLIP-seq
MIRT1175759	hsa-miR-670	CLIP-seq
MIRT1175760	hsa-miR-876-5p	CLIP-seq
MIRT2050857	hsa-miR-1207-3p	CLIP-seq
MIRT2050858	hsa-miR-1302	CLIP-seq
MIRT2050859	hsa-miR-198	CLIP-seq
MIRT2050860	hsa-miR-2278	CLIP-seq
MIRT2050861	hsa-miR-4298	CLIP-seq
MIRT2050862	hsa-miR-520a-5p	CLIP-seq
MIRT2050863	hsa-miR-525-5p	CLIP-seq
MIRT2050864	hsa-miR-603	CLIP-seq
MIRT2279969	hsa-miR-1207-5p	CLIP-seq
MIRT2279970	hsa-miR-141	CLIP-seq
MIRT2279971	hsa-miR-149	CLIP-seq
MIRT2050859	hsa-miR-198	CLIP-seq
MIRT2279972	hsa-miR-200a	CLIP-seq
MIRT2050860	hsa-miR-2278	CLIP-seq
MIRT2279973	hsa-miR-24	CLIP-seq
MIRT2279974	hsa-miR-3154	CLIP-seq
MIRT2279975	hsa-miR-3155	CLIP-seq
MIRT2279976	hsa-miR-3155b	CLIP-seq
MIRT2279977	hsa-miR-3157-5p	CLIP-seq
MIRT2279978	hsa-miR-3183	CLIP-seq
MIRT2279979	hsa-miR-3925-3p	CLIP-seq
MIRT2279980	hsa-miR-4270	CLIP-seq
MIRT2279981	hsa-miR-4279	CLIP-seq
MIRT2279982	hsa-miR-4418	CLIP-seq
MIRT2279983	hsa-miR-4436b-3p	CLIP-seq
MIRT2279984	hsa-miR-4441	CLIP-seq
MIRT2279985	hsa-miR-4691-3p	CLIP-seq
MIRT2279986	hsa-miR-4723-3p	CLIP-seq
MIRT2279987	hsa-miR-4763-3p	CLIP-seq
MIRT2279988	hsa-miR-484	CLIP-seq
MIRT2279989	hsa-miR-509-3-5p	CLIP-seq
MIRT2279990	hsa-miR-509-5p	CLIP-seq
MIRT2050862	hsa-miR-520a-5p	CLIP-seq
MIRT2050863	hsa-miR-525-5p	CLIP-seq
MIRT2279991	hsa-miR-617	CLIP-seq
MIRT2279992	hsa-miR-651	CLIP-seq
MIRT2279993	hsa-miR-766	CLIP-seq
MIRT2279994	hsa-miR-935	CLIP-seq
MIRT2391405	hsa-miR-3151	CLIP-seq
MIRT2391406	hsa-miR-342-5p	CLIP-seq
MIRT2391407	hsa-miR-377	CLIP-seq
MIRT2391408	hsa-miR-4651	CLIP-seq
MIRT2391409	hsa-miR-4664-5p	CLIP-seq
MIRT2391410	hsa-miR-486-3p	CLIP-seq
MIRT2050864	hsa-miR-603	CLIP-seq
MIRT2391411	hsa-miR-608	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005540	Function	Hyaluronic acid binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007417	Process	Central nervous system development	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0043202	Component	Lysosomal lumen	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045202	Component	Synapse	IBA
GO:0072534	Component	Perineuronal net	IBA

Other IDs

• MIM: 600826
• HGNC: 2465
• e!Ensembl: ENSG00000130287

Protein

• UniProt ID: O14594
• Protein name: Neurocan core protein (Chondroitin sulfate proteoglycan 3)
• Protein function: May modulate neuronal adhesion and neurite growth during development by binding to neural cell adhesion molecules (NG-CAM and N-CAM). Chondroitin sulfate proteoglycan; binds to hyaluronic acid.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	43 → 158	Immunoglobulin V-set domain	Domain
  PF00193	Xlink	160 → 254	Extracellular link domain	Domain
  PF00193	Xlink	261 → 356	Extracellular link domain	Domain
  PF00008	EGF	1012 → 1042	EGF-like domain	Domain
  PF00059	Lectin_C	1105 → 1210	Lectin C-type domain	Domain
  PF00084	Sushi	1215 → 1271	Sushi repeat (SCR repeat)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Brain. {ECO:0000269|PubMed:25326458}.
• Sequence:

  MGAPFVWALGLLMLQMLLFVAGEQGTQDITDASERGLHMQKLGSGSVQAALAELVALPCL
  FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRR
  ANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQE
  ACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
  GRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
  LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAERFDAYCFRAHH
  PTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEETLILE
  EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPMPRRR
  GRFKGLNGRYFQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLAMAVTEMLGSGQSRSP
  WADLTNEVDMPGAGSAGGKSSPEPWLWPPTMVPPSISGHSRAPVLELEKAEGPSARPATP
  DLFWSPLEATVSAPSPAPWEAFPVATSPDLPMMAMLRGPKEWMLPHPTPISTEANRVEAH
  GEATATAPPSPAAETKVYSLPLSLTPTGQGGEAMPTTPESPRADFRETGETSPAQVNKAE
  HSSSSPWPSVNRNVAVGFVPTETATEPTGLRGIPGSESGVFDTAESPTSGLQATVDEVQD
  PWPSVYSKGLDASSPSAPLGSPGVFLVPKVTPNLEPWVATDEGPTVNPMDSTVTPAPSDA
  SGIWEPGSQVFEEAESTTLSPQVALDTSIVTPLTTLEQGDKVGVPAMSTLGSSSSQPHPE
  PEDQVETQGTSGASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLL
  PVTLGIEDFELEVLAGSPGVESFWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHG
  GTCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSYGGSF
  CEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAEKDCRRRSGHLTSVHSPEEHSFINSFGH
  ENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPC
  NYNLPYVCKKGTVLCGPPPAVENASLIGARKAKYNVHATVRYQCNEGFAQHHVATIRCRS
  NGKWDRPQIVCTKPRRSHRMRRHHHHHQHHHQHHHHKSRKERRKHKKHPTEDWEKDEGNF
  C

• Sequence length: 1321

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR II DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental dyslexia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	24946282		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36982604	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21997179	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	23712748	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	23712748		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21353194, 22497794, 22952076, 23198940, 23712748, 23795679, 24955366, 25801500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASDB_DG	21353194		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	21353194, 31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23198940, 23712748, 23795679, 24955366, 25220293		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	23198940, 23712748, 25220293, 25801500, 32306996	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	26039340		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	30980710	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	30980710	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37146093	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	37146093	Associate	★☆☆☆☆ Found in Text Mining only
Depressed bipolar I disorder	Depressed bipolar disorder	GWASCAT_DG	31043756		★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	25801500	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	25801500	Associate	★☆☆☆☆ Found in Text Mining only
Developmental reading disorder	Developmental dyslexia	BEFREE	28839234		★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	Pubtator	28839234	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	34722763	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	23416328, 23594525	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25246029		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	32568739	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24946282, 30506232		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	24946282		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	25246029	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25801500		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	26039340		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29290949		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	22952076		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31228212		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31228212	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29290949		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30977985		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29290949		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30977985		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21423719, 23594525, 24477042, 24946282, 24978903, 26758378, 27887608, 30646922		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	GWASDB_DG	21423719		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23594525, 24477042	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	23594525		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37673381	Associate	★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31668939		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20950796, 22497794, 23198940, 23795679, 25220293		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22497794, 23795679, 25220293		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23198940, 25220293, 33070392	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Steatohepatitis	Fatty Liver	BEFREE	23594525, 25246029		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	25801500		★☆☆☆☆ Found in Text Mining only