Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	1463
Gene name	Neurocan
Gene symbol	NCAN
Synonyms (NCBI Gene)	CSPG3
Chromosome	19
Chromosome location	19p13.11
Summary	Neurocan is a chondroitin sulfate proteoglycan thought to be involved in the modulation of cell adhesion and migration.[supplied by OMIM, Jul 2002]

128 Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043672	hsa-miR-342-3p	CLASH	23622248
MIRT724671	hsa-miR-6165	HITS-CLIP	19536157
MIRT724670	hsa-miR-214-3p	HITS-CLIP	19536157
MIRT724669	hsa-miR-3619-5p	HITS-CLIP	19536157
MIRT724668	hsa-miR-761	HITS-CLIP	19536157
MIRT724667	hsa-miR-4530	HITS-CLIP	19536157
MIRT724666	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT724665	hsa-miR-1286	HITS-CLIP	19536157
MIRT724664	hsa-miR-711	HITS-CLIP	19536157
MIRT724663	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT570234	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT570233	hsa-miR-8068	PAR-CLIP	20371350
MIRT570232	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT570231	hsa-miR-147a	PAR-CLIP	20371350
MIRT570230	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT570229	hsa-miR-4455	PAR-CLIP	20371350
MIRT570228	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT731610	hsa-miR-24-3p	Luciferase reporter assayqRT-PCRWestern blot	27349868
MIRT731610	hsa-miR-24-3p	Luciferase reporter assayqRT-PCRWestern blot	27349868
MIRT724671	hsa-miR-6165	HITS-CLIP	19536157
MIRT724670	hsa-miR-214-3p	HITS-CLIP	19536157
MIRT724669	hsa-miR-3619-5p	HITS-CLIP	19536157
MIRT724668	hsa-miR-761	HITS-CLIP	19536157
MIRT724667	hsa-miR-4530	HITS-CLIP	19536157
MIRT724666	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT724665	hsa-miR-1286	HITS-CLIP	19536157
MIRT724664	hsa-miR-711	HITS-CLIP	19536157
MIRT724663	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT570234	hsa-miR-6867-5p	PAR-CLIP	20371350
MIRT570233	hsa-miR-8068	PAR-CLIP	20371350
MIRT570232	hsa-miR-6818-5p	PAR-CLIP	20371350
MIRT570231	hsa-miR-147a	PAR-CLIP	20371350
MIRT570230	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT570229	hsa-miR-4455	PAR-CLIP	20371350
MIRT570228	hsa-miR-574-5p	PAR-CLIP	20371350
MIRT1175714	hsa-miR-125a-5p	CLIP-seq
MIRT1175715	hsa-miR-125b	CLIP-seq
MIRT1175716	hsa-miR-1264	CLIP-seq
MIRT1175717	hsa-miR-1273f	CLIP-seq
MIRT1175718	hsa-miR-1290	CLIP-seq
MIRT1175719	hsa-miR-1343	CLIP-seq
MIRT1175720	hsa-miR-147	CLIP-seq
MIRT1175721	hsa-miR-183	CLIP-seq
MIRT1175722	hsa-miR-2113	CLIP-seq
MIRT1175723	hsa-miR-297	CLIP-seq
MIRT1175724	hsa-miR-3149	CLIP-seq
MIRT1175725	hsa-miR-3166	CLIP-seq
MIRT1175726	hsa-miR-3167	CLIP-seq
MIRT1175727	hsa-miR-3169	CLIP-seq
MIRT1175728	hsa-miR-3647-3p	CLIP-seq
MIRT1175729	hsa-miR-3685	CLIP-seq
MIRT1175730	hsa-miR-3690	CLIP-seq
MIRT1175731	hsa-miR-376c	CLIP-seq
MIRT1175732	hsa-miR-378g	CLIP-seq
MIRT1175733	hsa-miR-380	CLIP-seq
MIRT1175734	hsa-miR-384	CLIP-seq
MIRT1175735	hsa-miR-4254	CLIP-seq
MIRT1175736	hsa-miR-4271	CLIP-seq
MIRT1175737	hsa-miR-4282	CLIP-seq
MIRT1175738	hsa-miR-4287	CLIP-seq
MIRT1175739	hsa-miR-4319	CLIP-seq
MIRT1175740	hsa-miR-4324	CLIP-seq
MIRT1175741	hsa-miR-4469	CLIP-seq
MIRT1175742	hsa-miR-4495	CLIP-seq
MIRT1175743	hsa-miR-4504	CLIP-seq
MIRT1175744	hsa-miR-4515	CLIP-seq
MIRT1175745	hsa-miR-4534	CLIP-seq
MIRT1175746	hsa-miR-455-5p	CLIP-seq
MIRT1175747	hsa-miR-4685-3p	CLIP-seq
MIRT1175748	hsa-miR-4685-5p	CLIP-seq
MIRT1175749	hsa-miR-4716-3p	CLIP-seq
MIRT1175750	hsa-miR-4725-3p	CLIP-seq
MIRT1175751	hsa-miR-4732-3p	CLIP-seq
MIRT1175752	hsa-miR-4778-3p	CLIP-seq
MIRT1175753	hsa-miR-4802-5p	CLIP-seq
MIRT1175754	hsa-miR-508-3p	CLIP-seq
MIRT1175755	hsa-miR-542-3p	CLIP-seq
MIRT1175756	hsa-miR-567	CLIP-seq
MIRT1175757	hsa-miR-599	CLIP-seq
MIRT1175758	hsa-miR-625	CLIP-seq
MIRT1175759	hsa-miR-670	CLIP-seq
MIRT1175760	hsa-miR-876-5p	CLIP-seq
MIRT2050857	hsa-miR-1207-3p	CLIP-seq
MIRT2050858	hsa-miR-1302	CLIP-seq
MIRT2050859	hsa-miR-198	CLIP-seq
MIRT2050860	hsa-miR-2278	CLIP-seq
MIRT2050861	hsa-miR-4298	CLIP-seq
MIRT2050862	hsa-miR-520a-5p	CLIP-seq
MIRT2050863	hsa-miR-525-5p	CLIP-seq
MIRT2050864	hsa-miR-603	CLIP-seq
MIRT2279969	hsa-miR-1207-5p	CLIP-seq
MIRT2279970	hsa-miR-141	CLIP-seq
MIRT2279971	hsa-miR-149	CLIP-seq
MIRT2050859	hsa-miR-198	CLIP-seq
MIRT2279972	hsa-miR-200a	CLIP-seq
MIRT2050860	hsa-miR-2278	CLIP-seq
MIRT2279973	hsa-miR-24	CLIP-seq
MIRT2279974	hsa-miR-3154	CLIP-seq
MIRT2279975	hsa-miR-3155	CLIP-seq
MIRT2279976	hsa-miR-3155b	CLIP-seq
MIRT2279977	hsa-miR-3157-5p	CLIP-seq
MIRT2279978	hsa-miR-3183	CLIP-seq
MIRT2279979	hsa-miR-3925-3p	CLIP-seq
MIRT2279980	hsa-miR-4270	CLIP-seq
MIRT2279981	hsa-miR-4279	CLIP-seq
MIRT2279982	hsa-miR-4418	CLIP-seq
MIRT2279983	hsa-miR-4436b-3p	CLIP-seq
MIRT2279984	hsa-miR-4441	CLIP-seq
MIRT2279985	hsa-miR-4691-3p	CLIP-seq
MIRT2279986	hsa-miR-4723-3p	CLIP-seq
MIRT2279987	hsa-miR-4763-3p	CLIP-seq
MIRT2279988	hsa-miR-484	CLIP-seq
MIRT2279989	hsa-miR-509-3-5p	CLIP-seq
MIRT2279990	hsa-miR-509-5p	CLIP-seq
MIRT2050862	hsa-miR-520a-5p	CLIP-seq
MIRT2050863	hsa-miR-525-5p	CLIP-seq
MIRT2279991	hsa-miR-617	CLIP-seq
MIRT2279992	hsa-miR-651	CLIP-seq
MIRT2279993	hsa-miR-766	CLIP-seq
MIRT2279994	hsa-miR-935	CLIP-seq
MIRT2391405	hsa-miR-3151	CLIP-seq
MIRT2391406	hsa-miR-342-5p	CLIP-seq
MIRT2391407	hsa-miR-377	CLIP-seq
MIRT2391408	hsa-miR-4651	CLIP-seq
MIRT2391409	hsa-miR-4664-5p	CLIP-seq
MIRT2391410	hsa-miR-486-3p	CLIP-seq
MIRT2050864	hsa-miR-603	CLIP-seq
MIRT2391411	hsa-miR-608	CLIP-seq

15 Show/Hide all (15)

GO ID	Ontology	Definition	Evidence
GO:0001501	Process	Skeletal system development	IBA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005540	Function	Hyaluronic acid binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007417	Process	Central nervous system development	IBA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0043202	Component	Lysosomal lumen	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0045202	Component	Synapse	IBA
GO:0072534	Component	Perineuronal net	IBA

MIM	HGNC	e!Ensembl
600826	2465	ENSG00000130287

O14594

Protein name

Neurocan core protein (Chondroitin sulfate proteoglycan 3)

Protein function

May modulate neuronal adhesion and neurite growth during development by binding to neural cell adhesion molecules (NG-CAM and N-CAM). Chondroitin sulfate proteoglycan; binds to hyaluronic acid.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00008	EGF	1012 → 1042	EGF-like domain	Domain
PF00059	Lectin_C	1105 → 1210	Lectin C-type domain	Domain
PF00084	Sushi	1215 → 1271	Sushi repeat (SCR repeat)	Domain
PF00193	Xlink	160 → 254	Extracellular link domain	Domain
PF00193	Xlink	261 → 356	Extracellular link domain	Domain
PF07686	V-set	43 → 158	Immunoglobulin V-set domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Brain. {ECO:0000269|PubMed:25326458}.

Sequence

MGAPFVWALGLLMLQMLLFVAGEQGTQDITDASERGLHMQKLGSGSVQAALAELVALPCL
FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPSYPRRR
ANATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRSARDRYALTFAEAQE
ACRLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAERFDAYCFRAHH
PTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEETLILE
EKQESQQTLSPTPGDPMLASWPTGEVWLSTVAPSPSDMGAGTAASSHTEVAPTDPMPRRR
GRFKGLNGRYFQQQEPEPGLQGGMEASAQPPTSEAAVNQMEPPLAMAVTEMLGSGQSRSP
WADLTNEVDMPGAGSAGGKSSPEPWLWPPTMVPPSISGHSRAPVLELEKAEGPSARPATP
DLFWSPLEATVSAPSPAPWEAFPVATSPDLPMMAMLRGPKEWMLPHPTPISTEANRVEAH
GEATATAPPSPAAETKVYSLPLSLTPTGQGGEAMPTTPESPRADFRETGETSPAQVNKAE
HSSSSPWPSVNRNVAVGFVPTETATEPTGLRGIPGSESGVFDTAESPTSGLQATVDEVQD
PWPSVYSKGLDASSPSAPLGSPGVFLVPKVTPNLEPWVATDEGPTVNPMDSTVTPAPSDA
SGIWEPGSQVFEEAESTTLSPQVALDTSIVTPLTTLEQGDKVGVPAMSTLGSSSSQPHPE
PEDQVETQGTSGASVPPHQSSPLGKPAVPPGTPTAASVGESASVSSGEPTVPWDPSSTLL
PVTLGIEDFELEVLAGSPGVESFWEEVASGEEPALPGTPMNAGAEEVHSDPCENNPCLHG
GTCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSYGGSF
CEKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAEKDCRRRSGHLTSVHSPEEHSFINSFGH
ENTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPC
NYNLPYVCKKGTVLCGPPPAVENASLIGARKAKYNVHATVRYQCNEGFAQHHVATIRCRS
NGKWDRPQIVCTKPRRSHRMRRHHHHHQHHHQHHHHKSRKERRKHKKHPTEDWEKDEGNF
C

Sequence length

1321

Interactions

View interactions

Reactome Pathway
A tetrasaccharide linker sequence is required for GAG synthesis
Chondroitin sulfate biosynthesis
Dermatan sulfate biosynthesis
CS/DS degradation
ECM proteoglycans
Defective B4GALT7 causes EDS, progeroid type
Defective B3GAT3 causes JDSSDHD
Defective CHST3 causes SEDCJD
Defective CHST14 causes EDS, musculocontractural type
Defective CHSY1 causes TPBS
Defective B3GALT6 causes EDSP2 and SEMDJL1

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (16)
BIPOLAR DISORDER	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	21353194, 31043756, 32606422, 33263727, 33686288, 34002096, 38154582	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	31043756, 34002096	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR II DISORDER	—	GWAS catalog	31043756	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental dyslexia	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	38154582	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	33686288	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	37040585	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	40341939	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	38374256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	38154582	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	26039340	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (52)
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	24946282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36982604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21997179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	23712748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	23712748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	21353194, 22497794, 22952076, 23198940, 23712748, 23795679, 24955366, 25801500		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	21353194, 31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASDB_DG	21353194		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23198940, 23712748, 23795679, 24955366, 25220293		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	23198940, 23712748, 25220293, 25801500, 32306996	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
IGSF21	2	["Pelvic organ prolapse","Urinary bladder neoplasms"]	0	[]	2	["GWAS catalog (Pelvic organ prolapse)","CTD (Urinary bladder neoplasms)"]
BGN	0	[]	11	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS","ECM proteoglycans"]	0	[]
BCAN	0	[]	11	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS","ECM proteoglycans"]	0	[]
CSPG5	0	[]	10	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS"]	0	[]
CSPG4	0	[]	10	["A tetrasaccharide linker sequence is required for GAG synthesis","Defective B4GALT7 causes EDS, progeroid type","Defective B3GAT3 causes JDSSDHD","Defective B3GALT6 causes EDSP2 and SEMDJL1","Dermatan sulfate biosynthesis","Chondroitin sulfate biosynthesis","CS\/DS degradation","Defective CHST3 causes SEDCJD","Defective CHST14 causes EDS, musculocontractural type","Defective CHSY1 causes TPBS"]	0	[]

NCAN (neurocan)

Bookmark This Gene