NBPF7P (NBPF member 7, pseudogene)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 343505 |
| Gene name | NBPF member 7, pseudogene |
| Gene symbol | NBPF7P |
| Synonyms (NCBI Gene) |
NBPF7
|
| Chromosome | 1 |
| Chromosome location | 1p12 |
| Summary | This gene is a member of the neuroblastoma breakpoint family (NBPF) which consists of dozens of recently duplicated genes primarily located in segmental duplications on human chromosome 1. This gene family has experienced its greatest expansion within the |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
|
|||||||||||
|
|||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
||||||||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
P0C2Y1 | |||||||||||||||
| Protein name | Putative NBPF family member NBPF7 (Putative neuroblastoma breakpoint family member 7) | |||||||||||||||
| Family and domains |
Pfam
|
|||||||||||||||
| Sequence |
MCLRFFSPVPGSTSSATNVTMVVSAGPWSSEKAEMNILEINEKLRPQLAENKQQFRNMKQ |
|||||||||||||||
| Sequence length | 421 | |||||||||||||||
| Interactions | View interactions | |||||||||||||||
|
Related Genes
Genes most often co-reported with NBPF7P across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to NBPF7P (see Related Genes above), that are NOT already directly curated for NBPF7P itself -- a lead worth checking, not a confirmed association.
0
|
|