NATD1 (N-acetyltransferase domain containing 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 256302
Gene name N-acetyltransferase domain containing 1
Gene symbol NATD1
Synonyms (NCBI Gene)
C17orf103Gtlf3b
Chromosome 17
Chromosome location 17p11.2
miRNA miRNA information provided by mirtarbase database.
23 Show/Hide all (23)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT742332 hsa-miR-4432 HITS-CLIP 23824327
MIRT742333 hsa-miR-508-5p HITS-CLIP 23824327
MIRT742334 hsa-miR-451b HITS-CLIP 23824327
MIRT742335 hsa-miR-3613-3p HITS-CLIP 23824327
MIRT742336 hsa-miR-6501-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
1
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N6N6
Protein name Protein NATD1 (N-acetyltransferase domain-containing protein 1)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14542 Acetyltransf_CG 29 → 110 GCN5-related N-acetyl-transferase Domain
Sequence 
MAHSAAAVPLGALEQGCPIRVEHDRRRRQFTVRLNGCHDRAVLLYEYVGKRIVDLQHTEV
PDAYRGRGIAKHLAKAALDFVVEEDLKAHLTCWYIQKYVKENPLPQYLERLQP
Sequence length 113
Interactions View interactions

No strongly related genes found yet for NATD1.

No additional diseases found yet through genes similar to NATD1.