Gene Gene information from NCBI Gene database.
Entrez ID 339983
Gene name N-acetyltransferase 8 like
Gene symbol NAT8L
Synonyms (NCBI Gene)
CML3NACEDNAT8-LIKE
Chromosome 4
Chromosome location 4p16.3
Summary This gene encodes a single-pass membrane protein, which contains a conserved sequence of the GCN5 or NAT superfamily of N-acetyltransferases and is a member of the N-acyltransferase (NAT) superfamily. This protein is a neuron-specific protein and is the N
SNPs SNP information provided by dbSNP.
1
SNP ID Visualize variation Clinical significance Consequence
rs587777212 GGCCGCCGGGGGGGCGCGG>- Pathogenic Frameshift variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
284
miRTarBase ID miRNA Experiments Reference
MIRT051308 hsa-miR-16-5p CLASH 23622248
MIRT050986 hsa-miR-17-5p CLASH 23622248
MIRT041507 hsa-miR-193b-3p CLASH 23622248
MIRT040445 hsa-miR-615-3p CLASH 23622248
MIRT036028 hsa-miR-1301-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 28514442, 32296183, 33961781
GO:0005737 Component Cytoplasm IDA 19524112, 20385109
GO:0005737 Component Cytoplasm IEA
GO:0005739 Component Mitochondrion IDA
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610647 26742 ENSG00000185818
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N9F0
Protein name N-acetylaspartate synthetase (NAA synthetase) (EC 2.3.1.17) (Camello-like protein 3) (N-acetyltransferase 8-like protein)
Protein function Catalyzes the synthesis of N-acetylaspartate acid (NAA) from L-aspartate and acetyl-CoA (PubMed:19524112, PubMed:19807691, PubMed:20385109). Promotes dopamine uptake by regulating TNF-alpha expression (By similarity). Attenuates methamphetamine-
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00583 Acetyltransf_1 152 264 Acetyltransferase (GNAT) family Family
Tissue specificity TISSUE SPECIFICITY: Expressed in brain. {ECO:0000269|PubMed:19807691}.
Sequence
MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPV
AQPHGGAGGAGPPGGRGVCIREFRAAEQEAARRIFYDGIMERIPNTAFRGLRQHPRAQLL
YALLAALCFAVSRSLLLTCLVPAALLGLRYYYSRKVIRAYLECALHTDMADIEQYYMKPP
GSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHN
YSAVVLGTTAVKVAAHKLYESLGF
RHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLR
EE
Sequence length 302
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Microcephaly Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
N-acetylaspartate deficiency no classifications from unflagged records ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NAT8L-related disorder Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Attention deficit hyperactivity disorder Attention Deficit Hyperactivity Disorder BEFREE 29203337
★☆☆☆☆
Found in Text Mining only
Canavan Disease Canavan Disease BEFREE 29456021
★☆☆☆☆
Found in Text Mining only
Carcinoma Squamous Cell Squamous cell carcinoma Pubtator 26511490 Stimulate
★☆☆☆☆
Found in Text Mining only
Depressive disorder Mental Depression BEFREE 31520691
★☆☆☆☆
Found in Text Mining only
Dwarfism Dwarfism HPO_DG
★☆☆☆☆
Found in Text Mining only
Global developmental delay Developmental Delay HPO_DG
★☆☆☆☆
Found in Text Mining only
Major Depressive Disorder Mental Depression BEFREE 29020418, 31520691
★☆☆☆☆
Found in Text Mining only
Mental Depression Mental Depression BEFREE 31520691
★☆☆☆☆
Found in Text Mining only
Microcephaly Microcephaly HPO_DG
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis Multiple Sclerosis BEFREE 27709268
★☆☆☆☆
Found in Text Mining only