NAT8B (N-acetyltransferase 8B (putative, gene/pseudogene))

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Diseases linked via similar genes

Gene

• Entrez ID: 51471
• Gene name: N-acetyltransferase 8B (putative, gene/pseudogene)
• Gene symbol: NAT8B
• Synonyms (NCBI Gene): CML2, Hcml2, NAT8BP
• Chromosome: 2
• Chromosome location: 2p13.1
• Summary: The protein encoded by this gene is highly similar to the N-acetyltransferase 8 (NAT8) gene product, which is a kidney and liver protein with homology to bacterial acetyltransferases involved in drug resistance. This gene is localized on chromosome 2 in t

miRNA Show/Hide all (8)

miRTarBase ID	miRNA	Experiments	Reference
MIRT2050445	hsa-miR-137	CLIP-seq
MIRT2050446	hsa-miR-25	CLIP-seq
MIRT2050447	hsa-miR-32	CLIP-seq
MIRT2050448	hsa-miR-363	CLIP-seq
MIRT2050449	hsa-miR-367	CLIP-seq
MIRT2050450	hsa-miR-3974	CLIP-seq
MIRT2050451	hsa-miR-92a	CLIP-seq
MIRT2050452	hsa-miR-92b	CLIP-seq

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001702	Process	Gastrulation with mouth forming second	NAS	11397015
GO:0004468	Function	L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	IEA
GO:0004468	Function	L-lysine N-acetyltransferase activity, acting on acetyl phosphate as donor	TAS
GO:0005515	Function	Protein binding	IPI	19011241, 24556617
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	19011241
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005793	Component	Endoplasmic reticulum-Golgi intermediate compartment	IDA	24556617
GO:0008080	Function	N-acetyltransferase activity	IBA
GO:0008080	Function	N-acetyltransferase activity	IEA
GO:0008080	Function	N-acetyltransferase activity	NAS	11397015
GO:0010628	Process	Positive regulation of gene expression	IMP	19011241, 24556617
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11397015
GO:0016241	Process	Regulation of macroautophagy	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016747	Function	Acyltransferase activity, transferring groups other than amino-acyl groups	IEA
GO:0018003	Process	Peptidyl-lysine N6-acetylation	IDA	19011241, 24556617
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IDA	19011241
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	24556617
GO:0050435	Process	Amyloid-beta metabolic process	IMP	19011241
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IDA	19011241, 24556617
GO:0061733	Function	Protein-lysine-acetyltransferase activity	IEA
GO:0140500	Process	Regulation of reticulophagy	ISS
GO:1990000	Process	Amyloid fibril formation	IEA
GO:1990000	Process	Amyloid fibril formation	TAS

Other IDs

• MIM: 608190
• HGNC: 30235
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9UHF3
• Protein name: N-acetyltransferase 8B (EC 2.3.1.-) (Acetyltransferase 1) (ATase1) (Camello-like protein 2) (Protein-lysine N6-acetyltransferase 8B)
• Protein function: Endoplasmic reticulum (ER)-membrane-bound lysine N-acetyltransferase catalyzing the N6-acetylation of lysine residues in the lumen of the ER in various proteins, including PROM1 and BACE1, using acetyl-CoA as acetyl donor (PubMed:19011241, PubMe
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00583	Acetyltransf_1	71 → 193	Acetyltransferase (GNAT) family	Family

• Sequence:

  MAPYHIRKYQESDRKSVVGLLSGGMAEHAPATFRRLLKLPRTLILLLGGALALLLVSGSW
  ILALVFSLSLLPALWFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVAESEEKVVG
  TVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFARDQGYSEVVLDTSNI
  QLSAMGLYQSLGFKKTGQSFFHVWARLVDLHTVHFIYHLPSAQAGRL

• Sequence length: 227

Pathways

Reactome Pathway:

Amyloid fiber formation

Related Genes

No strongly related genes found yet for NAT8B.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NAT8B.