NAP1L6P (nucleosome assembly protein 1 like 6, pseudogene)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 645996 |
| Gene name | Nucleosome assembly protein 1 like 6, pseudogene |
| Gene symbol | NAP1L6P |
| Synonyms (NCBI Gene) |
NAP1L6lncNAP1L6
|
| Chromosome | X |
| Chromosome location | Xq13.2 |
|
Gene ontology (GO)
Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
|
||||||||||||||||
|
||||||||||||||||
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|||||||||||
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A6NFF2 | ||||||||||
| Protein name | Putative nucleosome assembly protein 1-like 6 | ||||||||||
| Family and domains |
Pfam
|
||||||||||
| Sequence |
MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAK |
||||||||||
| Sequence length | 107 | ||||||||||
| Interactions | View interactions | ||||||||||
|
Related Genes
Genes most often co-reported with NAP1L6P across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to NAP1L6P (see Related Genes above), that are NOT already directly curated for NAP1L6P itself -- a lead worth checking, not a confirmed association.
0
|
|