Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4675
Gene name	Nucleosome assembly protein 1 like 3
Gene symbol	NAP1L3
Synonyms (NCBI Gene)	MB20NPL3
Chromosome	X
Chromosome location	Xq21.32
Summary	This gene is intronless and encodes a member of the nucleosome assembly protein (NAP) family. This gene is linked closely to a region of genes responsible for several X-linked cognitive disability syndromes. [provided by RefSeq, Dec 2010]

20 Show/Hide all (20)

miRTarBase ID	miRNA	Experiments
MIRT1173675	hsa-miR-105	CLIP-seq
MIRT1173676	hsa-miR-1245	CLIP-seq
MIRT1173677	hsa-miR-144	CLIP-seq
MIRT1173678	hsa-miR-23a	CLIP-seq
MIRT1173679	hsa-miR-23b	CLIP-seq
MIRT1173680	hsa-miR-23c	CLIP-seq
MIRT1173681	hsa-miR-300	CLIP-seq
MIRT1173682	hsa-miR-3616-5p	CLIP-seq
MIRT1173683	hsa-miR-3646	CLIP-seq
MIRT1173684	hsa-miR-3647-5p	CLIP-seq
MIRT1173685	hsa-miR-381	CLIP-seq
MIRT1173686	hsa-miR-4684-3p	CLIP-seq
MIRT1173687	hsa-miR-4795-5p	CLIP-seq
MIRT1173688	hsa-miR-5096	CLIP-seq
MIRT1173689	hsa-miR-573	CLIP-seq
MIRT1173690	hsa-miR-576-3p	CLIP-seq
MIRT1173686	hsa-miR-4684-3p	CLIP-seq
MIRT1173675	hsa-miR-105	CLIP-seq
MIRT1173677	hsa-miR-144	CLIP-seq
MIRT1173683	hsa-miR-3646	CLIP-seq

9 Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0003682	Function	Chromatin binding	IBA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006334	Process	Nucleosome assembly	IBA
GO:0006334	Process	Nucleosome assembly	IEA
GO:0006334	Process	Nucleosome assembly	TAS	8976385
GO:0042393	Function	Histone binding	IBA

MIM	HGNC	e!Ensembl
300117	7639	ENSG00000186310

Q99457

Protein name

Nucleosome assembly protein 1-like 3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00956	NAP	106 → 487	Nucleosome assembly protein (NAP)	Family

Sequence

MAEADFKMVSEPVAHGVAEEEMASSTSDSGEESDSSSSSSSTSDSSSSSSTSGSSSGSGS
SSSSSGSTSSRSRLYRKKRVPEPSRRARRAPLGTNFVDRLPQAVRNRVQALRNIQDECDK
VDTLFLKAIHDLERKYAELNKPLYDRRFQIINAEYEPTEEECEWNSEDEEFSSDEEVQDN
TPSEMPPLEGEEEENPKENPEVKAEEKEVPKEIPEVKDEEKEVPKEIPEVKAEEKADSKD
CMEATPEVKEDPKEVPQVKADDKEQPKATEAKARAAVRETHKRVPEERLQDSVDLKRARK
GKPKREDPKGIPDYWLIVLKNVDKLGPMIQKYDEPILKFLSDVSLKFSKPGQPVSYTFEF
HFLPNPYFRNEVLVKTYIIKAKPDHNDPFFSWGWEIEDCKGCKIDWRRGKDVTVTTTQSR
TTATGEIEIQPRVVPNASFFNFFSPPEIPMIGKLEPREDAILDEDFEIGQILHDNVILKS
IYYYTGEVNGTYYQFGKHYGNKKYRK

Sequence length

506

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Abnormality of neuronal migration	Benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes Genes most often co-reported with NAP1L3 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for NAP1L3.

Diseases Linked via Similar Genes Diseases curated for genes most similar to NAP1L3 (see Related Genes above), that are NOT already directly curated for NAP1L3 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to NAP1L3.

NAP1L3 (nucleosome assembly protein 1 like 3)

Bookmark This Gene