NANOGP1 (Nanog homeobox pseudogene 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 404635
Gene name Nanog homeobox pseudogene 1
Gene symbol NANOGP1
Synonyms (NCBI Gene)
NANOG2
Chromosome 12
Chromosome location 12p13.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 23099 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N7R0
Protein name Putative homeobox protein NANOG2
Protein function Probable transcriptional regulator.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 39 → 95 Homeodomain Domain
Sequence 
MDLPIQDSHDSSTSPKGKQPTTAEKSATKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQ
KYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWLKNSNGVTQGCLVNPTGNL
PMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPFYNCGEESLQSCMQ
FQPNSPASDLQAALEAAGEGLNVIQQTTRYFNTPQTMDLFLNYSMNMQPEDV
Sequence length 232
Interactions View interactions

No strongly related genes found yet for NANOGP1.

No additional diseases found yet through genes similar to NANOGP1.