NANOGNB (NANOG neighbor homeobox)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 360030
Gene name NANOG neighbor homeobox
Gene symbol NANOGNB
Synonyms (NCBI Gene)
-
Chromosome 12
Chromosome location 12p13.31
miRNA miRNA information provided by mirtarbase database.
14 Show/Hide all (14)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT527751 hsa-miR-548c-3p PAR-CLIP 22012620
MIRT527746 hsa-miR-101-3p PAR-CLIP 22012620
MIRT527750 hsa-miR-144-3p PAR-CLIP 22012620
MIRT527749 hsa-miR-6841-5p PAR-CLIP 22012620
MIRT527748 hsa-miR-6755-5p PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0003700 Function DNA-binding transcription factor activity NAS 34673265
GO:0005634 Component Nucleus IEA
GO:0006357 Process Regulation of transcription by RNA polymerase II NAS 34673265
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620692 24958 ENSG00000205857
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z5D8
Protein name NANOG neighbor homeobox (Homeobox protein C14)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 92 → 159 Homeodomain Domain
Sequence 
MHRARWLTPVIPALWEAEAGRSRGQEIETILANKKQSAMPWDQDPEQSTGNYSEDEQNGK
QKWREEGEAGRKREREKEEKNEKELQDEQENKRKRENEKQKQYPEKRLVSKSLMHTLWAK
FKLNRCPTIQESLSLSFEFDMTHKQISQWFCKTRKKYNKEMSKRKHKKKHMRWRSLCCQG
WSRTPALK
Sequence length 188
Interactions View interactions

No strongly related genes found yet for NANOGNB.

No additional diseases found yet through genes similar to NANOGNB.