NALF1 (NALCN channel auxiliary factor 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 728215
Gene name NALCN channel auxiliary factor 1
Gene symbol NALF1
Synonyms (NCBI Gene)
FAM155ANLF-1NLF1
Chromosome 13
Chromosome location 13q33.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6 Show/Hide all (6)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 32494638
GO:0005886 Component Plasma membrane IEA
GO:0015275 Function Stretch-activated, monoatomic cation-selective, calcium channel activity IBA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
619899 33877 ENSG00000204442
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B1AL88
Protein name NALCN channel auxiliary factor 1 (Transmembrane protein FAM155A)
Protein function Auxillary component of the NALCN sodium channel complex, a channel that regulates the resting membrane potential and controls neuronal excitability.
PDB 6XIW , 7CM3 , 7SX3 , 7SX4 , 7WJI
Family and domains
Sequence 
MTRGAWMCRQYDDGLKIWLAAPRENEKPFIDSERAQKWRLSLASLLFFTVLLSDHLWFCA
EAKLTRARDKEHQQQQRQQQQQQQQQRQRQQQQQQRRQQEPSWPALLASMGESSPAAQAH
RLLSASSSPTLPPSPGDGGGGGGKGNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQ
CFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPLWNLSDFYLSFCNSYTLWELFSGLSS
PNTLNCSLDVVLKEGGEMTTCRQCVEAYQDYDHHAQEKYEEFESVLHKYLQSEEYSVKSC
PEDCKIVYKAWLCSQYFEVTQFNCRKTIPCKQYCLEVQTRCPFILPDNDEVIYGGLSSFI
CTGLYETFLTNDEPECCDVRREEKSNNPSKGTVEKSGSCHRTSLTVSSATRLCNSRLKLC
VLVLILLHTVLTASAAQNTAGLSFGGINTLEENSTNEE
Sequence length 458
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
33
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (33)
Phenotype Name Clinical Significance Source Reference Evidence Score
ALZHEIMER DISEASE — GWAS catalog 33654092
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA — GWAS catalog 21079607
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION — GWAS catalog 40645996
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog 18951430, 23453885
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER — GWAS catalog 23453885
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Show/Hide Text Mining Associations (16)
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 37333771 Associate
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Carcinoma Renal Cell Renal cell carcinoma Pubtator 31099194 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Clear-cell metastatic renal cell carcinoma Renal Carcinoma BEFREE 31099194
★★★★★
★☆☆☆☆
Found in Text Mining only
Cleft Palate Cleft palate Pubtator 16909398 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Diverticular Bleeding Diverticular Bleeding CTD_human_DG 30177863
★★★★★
★☆☆☆☆
Found in Text Mining only
Diverticular Diseases Diverticular disease Pubtator 28585551 Associate
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Diverticular Diseases Diverticular Diseases BEFREE 28585551
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Diverticular Diseases Diverticular Diseases GWASCAT_DG 28585551, 30177863, 30661054
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Diverticular Diseases Diverticular Diseases CTD_human_DG 30177863
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Diverticulitis Diverticulitis CTD_human_DG 28585551
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sort by:
ZZEF1 3 shared diseasesAnorexia nervosa, Diverticular disease, Psychiatric disorders 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Diverticular disease), GWAS catalog (Psychiatric disorders) Related via 3 shared diseases including Anorexia nervosa, Diverticular disease — evidence mostly GWAS catalog. STARD13 3 shared diseasesColorectal adenoma, Diverticular disease, Psychiatric disorders 3 shared evidence sourcesGWAS catalog (Colorectal adenoma), GWAS catalog (Diverticular disease), GWAS catalog (Psychiatric disorders) Related via 3 shared diseases including Colorectal adenoma, Diverticular disease — evidence mostly GWAS catalog. VGLL4 2 shared diseasesAnorexia nervosa, Eating disorder 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Eating disorder), GWAS catalog (Stroke) Related via 2 shared diseases including Anorexia nervosa, Eating disorder — evidence mostly GWAS catalog. LIG4 4 shared diseasesConduct disorder, Irritable bowel syndrome, Psychiatric disorders, Spondylosis 4 shared evidence sourcesGWAS catalog (Conduct disorder), GWAS catalog (Irritable bowel syndrome), GWAS catalog (Psychiatric disorders), GWAS catalog (Spondylosis) Related via 4 shared diseases including Conduct disorder, Irritable bowel syndrome — evidence mostly GWAS catalog. SORCS2 3 shared diseasesAnorexia nervosa, Vascular dementia, Eating disorder 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Eating disorder), GWAS catalog (Vascular dementia) Related via 3 shared diseases including Anorexia nervosa, Vascular dementia — evidence mostly GWAS catalog.
Color vision deficiency Linked via 2 of 5 related genesVGLL4, SORCS2 Insomnia Linked via 2 of 5 related genesVGLL4, SORCS2 Diabetes mellitus Linked via 1 of 5 related genesZZEF1 Metabolic syndrome Linked via 1 of 5 related genesZZEF1 Brain aneurysm Linked via 1 of 5 related genesSTARD13