NABP2 (nucleic acid binding protein 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 79035
• Gene name: Nucleic acid binding protein 2
• Gene symbol: NABP2
• Synonyms (NCBI Gene): OBFC2B, SOSS-B1, SSB1, hSSB1
• Chromosome: 12
• Chromosome location: 12q13.3
• Summary: Single-stranded DNA (ssDNA)-binding proteins, such as OBFC2B, are ubiquitous and essential for a variety of DNA metabolic processes, including replication, recombination, and detection and repair of damage (Richard et al., 2008 [PubMed 18449195]).[supplie

miRNA Show/Hide all (7)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052069	hsa-let-7b-5p	CLASH	23622248
MIRT046935	hsa-miR-221-3p	CLASH	23622248
MIRT043716	hsa-miR-342-3p	CLASH	23622248
MIRT042316	hsa-miR-484	CLASH	23622248
MIRT041020	hsa-miR-505-3p	CLASH	23622248
MIRT040604	hsa-miR-92b-3p	CLASH	23622248
MIRT039164	hsa-miR-769-5p	CLASH	23622248

Gene ontology (GO) Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	IBA
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	19683501
GO:0000724	Process	Double-strand break repair via homologous recombination	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	19605351
GO:0000781	Component	Chromosome, telomeric region	IDA	25589350
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IDA	18449195, 19683501
GO:0005515	Function	Protein binding	IPI	18449195, 19683501, 21242961, 21659603, 28506294, 33961781
GO:0005634	Component	Nucleus	IDA	18449195, 19683501
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IMP	18449195, 19683501
GO:0006281	Process	DNA repair	ISS
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	18449195, 19683501
GO:0010212	Process	Response to ionizing radiation	IBA
GO:0010212	Process	Response to ionizing radiation	IEA
GO:0010212	Process	Response to ionizing radiation	IMP	19605351, 19683501
GO:0035861	Component	Site of double-strand break	IDA	19683501
GO:0035861	Component	Site of double-strand break	IEA
GO:0044818	Process	Mitotic G2/M transition checkpoint	IBA
GO:0044818	Process	Mitotic G2/M transition checkpoint	IDA	19683501
GO:0044818	Process	Mitotic G2/M transition checkpoint	IEA
GO:0044818	Process	Mitotic G2/M transition checkpoint	IMP	19683501
GO:0061730	Function	C-rich strand telomeric DNA binding	IDA	25589350
GO:0070182	Function	DNA polymerase binding	IPI	25589350
GO:0070200	Process	Establishment of protein localization to telomere	IMP	25589350
GO:0070876	Component	SOSS complex	IBA
GO:0070876	Component	SOSS complex	IDA	18449195, 19683501
GO:0070876	Component	SOSS complex	IEA
GO:0070876	Component	SOSS complex	IPI	24630995
GO:0098505	Function	G-rich strand telomeric DNA binding	IDA	25589350
GO:1904355	Process	Positive regulation of telomere capping	IEA
GO:1904355	Process	Positive regulation of telomere capping	IMP	25589350

Other IDs

• MIM: 612104
• HGNC: 28412
• e!Ensembl: ENSG00000139579

Protein

• UniProt ID: Q9BQ15
• Protein name: SOSS complex subunit B1 (Nucleic acid-binding protein 2) (Oligonucleotide/oligosaccharide-binding fold-containing protein 2B) (Sensor of single-strand DNA complex subunit B1) (Sensor of ssDNA subunit B1) (SOSS-B1) (Single-stranded DNA-binding protein 1) (
• Protein function: Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint (PubMed:25249620). In the SOSS complex, acts as a sensor of single-stranded DNA that binds to single-str
• PDB: 4OWT , 4OWW , 4OWX , 5D8E , 5D8F , 8RBZ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01336	tRNA_anti-codon	23 → 104	OB-fold nucleic acid binding domain	Domain

• Sequence:

  MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGN
  LIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQA
  PNKAVQNDSNPSASQPTTGPSAASPASENQNGNGLSAPPGPGGGPHPPHTPSHPPSTRIT
  RSQPNHTPAGPPGPSSNPVSNGKETRRSSKR

• Sequence length: 211

Pathways

Reactome Pathway:

RNA polymerase II transcribes snRNA genes

Related Genes

No strongly related genes found yet for NABP2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to NABP2.