NAALADL2 (N-acetylated alpha-linked acidic dipeptidase like 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 254827
• Gene name: N-acetylated alpha-linked acidic dipeptidase like 2
• Gene symbol: NAALADL2
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3q26.31

miRNA Show/Hide all (127)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1172342	hsa-miR-1	CLIP-seq
MIRT1172343	hsa-miR-206	CLIP-seq
MIRT1172344	hsa-miR-3119	CLIP-seq
MIRT1172345	hsa-miR-3125	CLIP-seq
MIRT1172346	hsa-miR-3152-3p	CLIP-seq
MIRT1172347	hsa-miR-3161	CLIP-seq
MIRT1172348	hsa-miR-34b	CLIP-seq
MIRT1172349	hsa-miR-3653	CLIP-seq
MIRT1172350	hsa-miR-3658	CLIP-seq
MIRT1172351	hsa-miR-3673	CLIP-seq
MIRT1172352	hsa-miR-3682-3p	CLIP-seq
MIRT1172353	hsa-miR-375	CLIP-seq
MIRT1172354	hsa-miR-3916	CLIP-seq
MIRT1172355	hsa-miR-3921	CLIP-seq
MIRT1172356	hsa-miR-3936	CLIP-seq
MIRT1172357	hsa-miR-4273	CLIP-seq
MIRT1172358	hsa-miR-4477a	CLIP-seq
MIRT1172359	hsa-miR-4502	CLIP-seq
MIRT1172360	hsa-miR-4653-5p	CLIP-seq
MIRT1172361	hsa-miR-4677-5p	CLIP-seq
MIRT1172362	hsa-miR-4695-3p	CLIP-seq
MIRT1172363	hsa-miR-4709-3p	CLIP-seq
MIRT1172364	hsa-miR-4714-3p	CLIP-seq
MIRT1172365	hsa-miR-4762-3p	CLIP-seq
MIRT1172366	hsa-miR-4799-5p	CLIP-seq
MIRT1172367	hsa-miR-582-3p	CLIP-seq
MIRT1172368	hsa-miR-613	CLIP-seq
MIRT2049825	hsa-miR-1275	CLIP-seq
MIRT2049826	hsa-miR-196a	CLIP-seq
MIRT2049827	hsa-miR-196b	CLIP-seq
MIRT2049828	hsa-miR-2909	CLIP-seq
MIRT2049829	hsa-miR-296-3p	CLIP-seq
MIRT1172355	hsa-miR-3921	CLIP-seq
MIRT2049830	hsa-miR-3927	CLIP-seq
MIRT2049831	hsa-miR-4260	CLIP-seq
MIRT2049832	hsa-miR-4525	CLIP-seq
MIRT2049833	hsa-miR-4650-3p	CLIP-seq
MIRT1172360	hsa-miR-4653-5p	CLIP-seq
MIRT2049834	hsa-miR-4665-5p	CLIP-seq
MIRT2049835	hsa-miR-4723-5p	CLIP-seq
MIRT2049836	hsa-miR-590-3p	CLIP-seq
MIRT2049837	hsa-miR-607	CLIP-seq
MIRT2049838	hsa-miR-625	CLIP-seq
MIRT1172342	hsa-miR-1	CLIP-seq
MIRT2049825	hsa-miR-1275	CLIP-seq
MIRT2278783	hsa-miR-1284	CLIP-seq
MIRT2278784	hsa-miR-1305	CLIP-seq
MIRT2278785	hsa-miR-139-5p	CLIP-seq
MIRT2278786	hsa-miR-190	CLIP-seq
MIRT2278787	hsa-miR-190b	CLIP-seq
MIRT2049826	hsa-miR-196a	CLIP-seq
MIRT2049827	hsa-miR-196b	CLIP-seq
MIRT2278788	hsa-miR-1976	CLIP-seq
MIRT1172343	hsa-miR-206	CLIP-seq
MIRT2278789	hsa-miR-2110	CLIP-seq
MIRT2278790	hsa-miR-2116	CLIP-seq
MIRT2278791	hsa-miR-2467-5p	CLIP-seq
MIRT2278792	hsa-miR-2681	CLIP-seq
MIRT2049828	hsa-miR-2909	CLIP-seq
MIRT2049829	hsa-miR-296-3p	CLIP-seq
MIRT2278793	hsa-miR-3120-3p	CLIP-seq
MIRT2278794	hsa-miR-3124-3p	CLIP-seq
MIRT2278795	hsa-miR-3150a-3p	CLIP-seq
MIRT2278796	hsa-miR-3175	CLIP-seq
MIRT2278797	hsa-miR-3188	CLIP-seq
MIRT2278798	hsa-miR-329	CLIP-seq
MIRT2278799	hsa-miR-337-3p	CLIP-seq
MIRT1172348	hsa-miR-34b	CLIP-seq
MIRT2278800	hsa-miR-3613-3p	CLIP-seq
MIRT2278801	hsa-miR-3614-3p	CLIP-seq
MIRT2278802	hsa-miR-362-3p	CLIP-seq
MIRT2278803	hsa-miR-3664-5p	CLIP-seq
MIRT2278804	hsa-miR-3671	CLIP-seq
MIRT1172351	hsa-miR-3673	CLIP-seq
MIRT2278805	hsa-miR-3684	CLIP-seq
MIRT2278806	hsa-miR-3685	CLIP-seq
MIRT2278807	hsa-miR-3690	CLIP-seq
MIRT2278808	hsa-miR-384	CLIP-seq
MIRT1172355	hsa-miR-3921	CLIP-seq
MIRT2049830	hsa-miR-3927	CLIP-seq
MIRT2278809	hsa-miR-3941	CLIP-seq
MIRT2278810	hsa-miR-3975	CLIP-seq
MIRT2278811	hsa-miR-421	CLIP-seq
MIRT2278812	hsa-miR-4254	CLIP-seq
MIRT2049831	hsa-miR-4260	CLIP-seq
MIRT2278813	hsa-miR-4264	CLIP-seq
MIRT2278814	hsa-miR-4271	CLIP-seq
MIRT2278815	hsa-miR-4279	CLIP-seq
MIRT2278816	hsa-miR-4307	CLIP-seq
MIRT2278817	hsa-miR-4328	CLIP-seq
MIRT2278818	hsa-miR-4452	CLIP-seq
MIRT2278819	hsa-miR-4470	CLIP-seq
MIRT2278820	hsa-miR-4639-3p	CLIP-seq
MIRT2278821	hsa-miR-4649-3p	CLIP-seq
MIRT2049833	hsa-miR-4650-3p	CLIP-seq
MIRT1172360	hsa-miR-4653-5p	CLIP-seq
MIRT2049834	hsa-miR-4665-5p	CLIP-seq
MIRT2278822	hsa-miR-4668-5p	CLIP-seq
MIRT1172361	hsa-miR-4677-5p	CLIP-seq
MIRT2278823	hsa-miR-4704-3p	CLIP-seq
MIRT2278824	hsa-miR-4705	CLIP-seq
MIRT2278825	hsa-miR-4714-5p	CLIP-seq
MIRT2278826	hsa-miR-4725-3p	CLIP-seq
MIRT2278827	hsa-miR-4780	CLIP-seq
MIRT2278828	hsa-miR-4789-5p	CLIP-seq
MIRT2278829	hsa-miR-485-5p	CLIP-seq
MIRT2278830	hsa-miR-548p	CLIP-seq
MIRT2278831	hsa-miR-579	CLIP-seq
MIRT2278832	hsa-miR-582-5p	CLIP-seq
MIRT2049836	hsa-miR-590-3p	CLIP-seq
MIRT2278833	hsa-miR-603	CLIP-seq
MIRT2049837	hsa-miR-607	CLIP-seq
MIRT1172368	hsa-miR-613	CLIP-seq
MIRT2278834	hsa-miR-623	CLIP-seq
MIRT2278835	hsa-miR-668	CLIP-seq
MIRT2278836	hsa-miR-939	CLIP-seq
MIRT2278811	hsa-miR-421	CLIP-seq
MIRT2278819	hsa-miR-4470	CLIP-seq
MIRT2431465	hsa-miR-450b-5p	CLIP-seq
MIRT2431466	hsa-miR-518a-5p	CLIP-seq
MIRT2431467	hsa-miR-527	CLIP-seq
MIRT2454811	hsa-miR-1279	CLIP-seq
MIRT2454812	hsa-miR-203	CLIP-seq
MIRT2454813	hsa-miR-3612	CLIP-seq
MIRT2454814	hsa-miR-4443	CLIP-seq
MIRT2278818	hsa-miR-4452	CLIP-seq
MIRT2454815	hsa-miR-650	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956
GO:0005654	Component	Nucleoplasm	IDA
GO:0009617	Process	Response to bacterium	IEA
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 608806
• HGNC: 23219
• e!Ensembl: ENSG00000177694

Protein

• UniProt ID: Q58DX5
• Protein name: Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2 (NAALADase L2)
• Protein function: May be catalytically inactive.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04389	Peptidase_M28	431 → 622	Peptidase family M28	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at higher level in kidney and placenta. In embryo, it is mainly confined to duodenal and stomach endoderm, mesonephros, metanephros and pancreas.
• Sequence:

  MGENEASLPNTSLQGKKMAYQKVHADQRAPGHSQYLDNDDLQATALDLEWDMEKELEESG
  FDQFQLDGAENQNLGHSETIDLNLDSIQPATSPKGRFQRLQEESDYITHYTRSAPKSNRC
  NFCHVLKILCTATILFIFGILIGYYVHTNCPSDAPSSGTVDPQLYQEILKTIQAEDIKKS
  FRNLVQLYKNEDDMEISKKIKTQWTSLGLEDVQFVNYSVLLDLPGPSPSTVTLSSSGQCF
  HPNGQPCSEEARKDSSQDLLYSYAAYSAKGTLKAEVIDVSYGMADDLKRIRKIKNVTNQI
  ALLKLGKLPLLYKLSSLEKAGFGGVLLYIDPCDLPKTVNPSHDTFMVSLNPGGDPSTPGY
  PSVDESFRQSRSNLTSLLVQPISAPLVAKLISSPKARTKNEACSSLELPNNEIRVVSMQV
  QTVTKLKTVTNVVGFVMGLTSPDRYIIVGSHHHTAHSYNGQEWASSTAIITAFIRALMSK
  VKRGWRPDRTIVFCSWGGTAFGNIGSYEWGEDFKKVLQKNVVAYISLHSPIRGNSSLYPV
  ASPSLQQLVVEKNNFNCTRRAQCPETNISSIQIQGDADYFINHLGVPIVQFAYEDIKTLE
  GPSFLSEARFSTRATKIEEMDPSFNLHETITKLSGEVILQIANEPVLPFNALDIALEVQN
  NLKGDQPNTHQLLAMALRLRESAELFQSDEMRPANDPKERAPIRIRMLNDILQDMEKSFL
  VKQAPPGFYRNILYHLDEKTSRFSILIEAWEHCKPLASNETLQEALSEVLNSINSAQVYF
  KAGLDVFKSVLDGKN

• Sequence length: 795

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (33)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	39998322, 40708016	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	32841424	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	26398136	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	24322204	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	37359372	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	40708016	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental cataract	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	28333195	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	36400179	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	21642993	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CARCINOMA	—	GWAS catalog	21642993	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	27770636	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	29924316	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29292387	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOCUTANEOUS LYMPH NODE SYNDROME	—	GWAS catalog	19132087	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NAALADL2-related disorder	Likely benign; Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	23251661	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	37040585	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROLIFERATIVE DIABETIC RETINOPATHY	—	GWAS catalog	30487263	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	25939597	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35396580	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	21408207	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	31488892	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (23)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autism Spectrum Disorder	Autism	Pubtator	26398136	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet Syndrome	BEFREE	28045058		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	28045058	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28145423	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28145423		★☆☆☆☆ Found in Text Mining only
Cornelia De Lange Syndrome	Cornelia De Lange Syndrome	BEFREE	15168106, 16160854		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	GWASCAT_DG	28333195		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	GWASCAT_DG	31201950		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	GWASCAT_DG	30796134		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28145423		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24240687		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24240687		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	GWASCAT_DG	19132087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	19132087	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	GWASDB_DG	19132087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	28145423		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	GWASCAT_DG	30487263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	24240687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	25939597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	24240687		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25939597, 27409348, 32796921	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37232821	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	25939597	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SLC16A7 2 shared diseasesKawasaki disease, Proliferative diabetic retinopathy 2 shared evidence sourcesGWAS catalog (Kawasaki disease), GWAS catalog (Proliferative diabetic retinopathy) Related via 2 shared diseases including Kawasaki disease, Proliferative diabetic retinopathy — evidence mostly GWAS catalog. STIM2 2 shared diseasesEosinophilia, Kawasaki disease 2 shared evidence sourcesGWAS catalog (Eosinophilia), GWAS catalog (Kawasaki disease) Related via 2 shared diseases including Eosinophilia, Kawasaki disease — evidence mostly GWAS catalog. ST6GAL1 2 shared diseasesEosinophilia, Esophageal cancer 2 shared evidence sourcesGWAS catalog (Eosinophilia), GWAS catalog (Esophageal cancer) Related via 2 shared diseases including Eosinophilia, Esophageal cancer — evidence mostly GWAS catalog. KLF13 2 shared diseasesEosinophilia, Pelvic organ prolapse 2 shared evidence sourcesGWAS catalog (Eosinophilia), GWAS catalog (Pelvic organ prolapse) Related via 2 shared diseases including Eosinophilia, Pelvic organ prolapse — evidence mostly GWAS catalog. EPG5 2 shared diseasesEsophageal cancer, Kawasaki disease 2 shared evidence sourcesGWAS catalog (Esophageal cancer), GWAS catalog (Kawasaki disease) Related via 2 shared diseases including Esophageal cancer, Kawasaki disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SLC16A7	2	["Kawasaki disease","Proliferative diabetic retinopathy"]	0	[]	2	["GWAS catalog (Kawasaki disease)","GWAS catalog (Proliferative diabetic retinopathy)"]
STIM2	2	["Eosinophilia","Kawasaki disease"]	0	[]	2	["GWAS catalog (Eosinophilia)","GWAS catalog (Kawasaki disease)"]
ST6GAL1	2	["Eosinophilia","Esophageal cancer"]	0	[]	2	["GWAS catalog (Eosinophilia)","GWAS catalog (Esophageal cancer)"]
KLF13	2	["Eosinophilia","Pelvic organ prolapse"]	0	[]	2	["GWAS catalog (Eosinophilia)","GWAS catalog (Pelvic organ prolapse)"]
EPG5	2	["Esophageal cancer","Kawasaki disease"]	0	[]	2	["GWAS catalog (Esophageal cancer)","GWAS catalog (Kawasaki disease)"]

Diseases Linked via Similar Genes

Colorectal cancer Linked via 3 of 5 related genesSLC16A7, STIM2, KLF13 Bronchial disease Linked via 2 of 5 related genesSTIM2, EPG5 Coronary artery disease Linked via 2 of 5 related genesSTIM2, EPG5 Myocardial infarction Linked via 2 of 5 related genesSTIM2, KLF13 Diabetes mellitus type 2 Linked via 2 of 5 related genesST6GAL1, KLF13

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Colorectal cancer	3	["SLC16A7","STIM2","KLF13"]
Bronchial disease	2	["STIM2","EPG5"]
Coronary artery disease	2	["STIM2","EPG5"]
Myocardial infarction	2	["STIM2","KLF13"]
Diabetes mellitus type 2	2	["ST6GAL1","KLF13"]