Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	90634
Gene name	NEDD4 binding protein 2 like 1
Gene symbol	N4BP2L1
Synonyms (NCBI Gene)	CG018
Chromosome	13
Chromosome location	13q13.1

22 Show/Hide all (22)

miRTarBase ID	miRNA	Experiments
MIRT1171094	hsa-miR-29a	CLIP-seq
MIRT1171095	hsa-miR-29b	CLIP-seq
MIRT1171096	hsa-miR-29c	CLIP-seq
MIRT1171097	hsa-miR-767-5p	CLIP-seq
MIRT1171098	hsa-miR-3140-3p	CLIP-seq
MIRT1171099	hsa-miR-3714	CLIP-seq
MIRT1171100	hsa-miR-4493	CLIP-seq
MIRT1171101	hsa-miR-4699-3p	CLIP-seq
MIRT1171102	hsa-miR-4704-5p	CLIP-seq
MIRT1171103	hsa-miR-940	CLIP-seq
MIRT2278381	hsa-miR-155	CLIP-seq
MIRT2278382	hsa-miR-219-5p	CLIP-seq
MIRT2278383	hsa-miR-3064-3p	CLIP-seq
MIRT2278384	hsa-miR-365	CLIP-seq
MIRT2278385	hsa-miR-4782-3p	CLIP-seq
MIRT2278386	hsa-miR-511	CLIP-seq
MIRT2454758	hsa-miR-1254	CLIP-seq
MIRT2454759	hsa-miR-3116	CLIP-seq
MIRT2454760	hsa-miR-3647-3p	CLIP-seq
MIRT2454761	hsa-miR-4496	CLIP-seq
MIRT2454762	hsa-miR-4727-5p	CLIP-seq
MIRT2454763	hsa-miR-661	CLIP-seq

MIM	HGNC	e!Ensembl
621053	25037	ENSG00000139597

Q5TBK1

Protein name

NEDD4-binding protein 2-like 1

Protein function

Might play a role in adipocyte differentiation and triglyceride accumulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13671	AAA_33	44 → 178		Domain

Sequence

MEDSFLQSFGRLSLQPQQQQQRQRPPRPPPRGTPPRRHSFRKHLYLLRGLPGSGKTTLAR
QLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQKRARKAMRNGISPIIIDNTN
LHAWEMKPYAVMALENNYEVIFREPDTRWKFNVQELARRNIHGVSREKIHRMKERYEHDV
TFHSVLHAEKPSRMNRNQDRNNALPSNNARYWNSYTEFPNRRAHGGFTNESSYHRRGGCH
HGY

Sequence length

243

Interactions

View interactions

Related Genes Genes most often co-reported with N4BP2L1 across shared curated disease and pathway associations. 0 Download as csv Download as pdf
No strongly related genes found yet for N4BP2L1.

Diseases Linked via Similar Genes Diseases curated for genes most similar to N4BP2L1 (see Related Genes above), that are NOT already directly curated for N4BP2L1 itself -- a lead worth checking, not a confirmed association. 0 Download as csv Download as pdf
No additional diseases found yet through genes similar to N4BP2L1.

N4BP2L1 (NEDD4 binding protein 2 like 1)

Bookmark This Gene