MZB1 (marginal zone B and B1 cell specific protein)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51237
• Gene name: Marginal zone B and B1 cell specific protein
• Gene symbol: MZB1
• Synonyms (NCBI Gene): MEDA-7, PACAP, pERp1
• Chromosome: 5
• Chromosome location: 5q31.2

miRNA Show/Hide all (6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT437479	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	24014023
MIRT2049197	hsa-miR-3158-3p	CLIP-seq
MIRT2049198	hsa-miR-516a-3p	CLIP-seq
MIRT2049199	hsa-miR-885-3p	CLIP-seq
MIRT2391303	hsa-miR-2392	CLIP-seq
MIRT2391304	hsa-miR-4323	CLIP-seq

Gene ontology (GO) Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002639	Process	Positive regulation of immunoglobulin production	IEA
GO:0002639	Process	Positive regulation of immunoglobulin production	ISS
GO:0005515	Function	Protein binding	IPI	11350957, 32296183
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	21688198
GO:0005576	Component	Extracellular region	IEA
GO:0005737	Component	Cytoplasm	IDA	11350957
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	21688198
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0030888	Process	Regulation of B cell proliferation	IBA
GO:0030888	Process	Regulation of B cell proliferation	IEA
GO:0030888	Process	Regulation of B cell proliferation	ISS
GO:0033622	Process	Integrin activation	IEA
GO:0033622	Process	Integrin activation	ISS
GO:0034663	Component	Endoplasmic reticulum chaperone complex	IBA
GO:0034663	Component	Endoplasmic reticulum chaperone complex	IEA
GO:0034663	Component	Endoplasmic reticulum chaperone complex	ISS
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	ISS
GO:0046626	Process	Regulation of insulin receptor signaling pathway	IEA
GO:0046626	Process	Regulation of insulin receptor signaling pathway	ISS

Other IDs

• MIM: 609447
• HGNC: 30125
• e!Ensembl: ENSG00000170476

Protein

• UniProt ID: Q8WU39
• Protein name: Marginal zone B- and B1-cell-specific protein (Mesenteric estrogen-dependent adipose 7) (MEDA-7) (Plasma cell-induced resident endoplasmic reticulum protein) (Plasma cell-induced resident ER protein) (pERp1) (Proapoptotic caspase adapter protein)
• Protein function: Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity (By simi
• PDB: 7AAH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11938	DUF3456	49 → 178	TLR4 regulator and MIR-interacting MSAP	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with highest levels in adult brain, small intestine and lymphoid tissues such as thymus and spleen. Expression is frequently lower in intestinal-type gastric cancer. In obese patients, more abundant in omental than in
• Sequence:

  MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQM
  WQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSE
  GPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSE
  KVSATREEL

• Sequence length: 189

Related Genes

No strongly related genes found yet for MZB1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MZB1.