MYOCOS (myocilin opposite strand)
|
Gene
Gene information from NCBI Gene database.
|
|
| Entrez ID | 110806290 |
| Gene name | Myocilin opposite strand |
| Gene symbol | MYOCOS |
| Synonyms (NCBI Gene) |
-
|
| Chromosome | 1 |
| Chromosome location | 1q24.3 |
|
Other IDs
Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
|
|||||||
|
|||||||
|
Protein
Protein information from UniProt database.
|
|
|
UniProt ID
Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
|
A0A1B0GUC4 |
| Protein name | Myocilin opposite strand protein |
| Family and domains | |
| Sequence |
MAQKSLANNSINLPYKDLTSEVTRRRVTMITRKEIITQKSDEAKEMLSHLDLEQAPPPHR |
| Sequence length | 108 |
| Interactions | View interactions |
|
Associated diseases
Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Evidence Score:
★☆☆☆☆ Gene-disease association found in Text Mining only
★★☆☆☆ Found in Text Mining and Unknown/Other Associations
★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources
★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Related Genes
Genes most often co-reported with MYOCOS across shared curated disease and pathway associations.
0
|
|
|
Diseases Linked via Similar Genes
Diseases curated for genes most similar to MYOCOS (see Related Genes above), that are NOT already directly curated for MYOCOS itself -- a lead worth checking, not a confirmed association.
0
|
|