MYO1G (myosin IG)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 64005
• Gene name: Myosin IG
• Gene symbol: MYO1G
• Synonyms (NCBI Gene): HA2, HLA-HA2, MHAG
• Chromosome: 7
• Chromosome location: 7p13
• Summary: MYO1G is a plasma membrane-associated class I myosin (see MIM 601478) that is abundant in T and B lymphocytes and mast cells (Pierce et al., 2001 [PubMed 11544309]; Patino-Lopez et al., 2010 [PubMed 20071333]).[supplied by OMIM, Jun 2010]

Gene ontology (GO) Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000146	Function	Microfilament motor activity	IBA
GO:0000166	Function	Nucleotide binding	IEA
GO:0001891	Component	Phagocytic cup	IEA
GO:0001891	Component	Phagocytic cup	ISS
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002456	Process	T cell mediated immunity	IEA
GO:0002456	Process	T cell mediated immunity	ISS
GO:0003774	Function	Cytoskeletal motor activity	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IEA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	ISS
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IEA
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	19968988
GO:0005886	Component	Plasma membrane	IEA
GO:0005902	Component	Microvillus	IBA
GO:0005902	Component	Microvillus	IEA
GO:0006887	Process	Exocytosis	IEA
GO:0006897	Process	Endocytosis	IBA
GO:0006909	Process	Phagocytosis	IEA
GO:0007015	Process	Actin filament organization	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016459	Component	Myosin complex	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030048	Process	Actin filament-based movement	IBA
GO:0030175	Component	Filopodium	IEA
GO:0031256	Component	Leading edge membrane	IEA
GO:0031589	Process	Cell-substrate adhesion	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IEA
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	ISS
GO:0051015	Function	Actin filament binding	IBA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071976	Process	Cell gliding	IEA
GO:0072678	Process	T cell migration	ISS
GO:0120117	Process	T cell meandering migration	IEA

Other IDs

• MIM: 600642
• HGNC: 13880
• e!Ensembl: ENSG00000136286

Protein

• UniProt ID: B0I1T2
• Protein name: Unconventional myosin-Ig [Cleaved into: Minor histocompatibility antigen HA-2 (mHag HA-2)]
• Protein function: Unconventional myosin required during immune response for detection of rare antigen-presenting cells by regulating T-cell migration. Unconventional myosins are actin-based motor molecules with ATPase activity and serve in intracellular movements
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00063	Myosin_head	11 → 694	Myosin head (motor domain)	Domain
  PF06017	Myosin_TH1	815 → 1003	Unconventional myosin tail, actin- and lipid-binding	Domain

• Tissue specificity: TISSUE SPECIFICITY: Specifically expressed in hematopoietic cells. {ECO:0000269|PubMed:11544309, ECO:0000269|PubMed:20071333}.
• Sequence:

  MEDEEGPEYGKPDFVLLDQVTMEDFMRNLQLRFEKGRIYTYIGEVLVSVNPYQELPLYGP
  EAIARYQGRELYERPPHLYAVANAAYKAMKHRSRDTCIVISGESGAGKTEASKHIMQYIA
  AVTNPSQRAEVERVKDVLLKSTCVLEAFGNARTNRNHNSSRFGKYMDINFDFKGDPIGGH
  IHSYLLEKSRVLKQHVGERNFHAFYQLLRGSEDKQLHELHLERNPAVYNFTHQGAGLNMT
  VHSALDSDEQSHQAVTEAMRVIGFSPEEVESVHRILAAILHLGNIEFVETEEGGLQKEGL
  AVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACAKAVY
  QRLFEWVVNRINSVMEPRGRDPRRDGKDTVIGVLDIYGFEVFPVNSFEQFCINYCNEKLQ
  QLFIQLILKQEQEEYEREGITWQSVEYFNNATIVDLVERPHRGILAVLDEACSSAGTITD
  RIFLQTLDMHHRHHLHYTSRQLCPTDKTMEFGRDFRIKHYAGDVTYSVEGFIDKNRDFLF
  QDFKRLLYNSTDPTLRAMWPDGQQDITEVTKRPLTAGTLFKNSMVALVENLASKEPFYVR
  CIKPNEDKVAGKLDENHCRHQVAYLGLLENVRVRRAGFASRQPYSRFLLRYKMTCEYTWP
  NHLLGSDKAAVSALLEQHGLQGDVAFGHSKLFIRSPRTLVTLEQSRARLIPIIVLLLQKA
  WRGTLARWRCRRLRAIYTIMRWFRRHKVRAHLAELQRRFQAARQPPLYGRDLVWPLPPAV
  LQPFQDTCHALFCRWRARQLVKNIPPSDMPQIKAKVAAMGALQGLRQDWGCRRAWARDYL
  SSATDNPTASSLFAQRLKTLQDKDGFGAVLFSSHVRKVNRFHKIRNRALLLTDQHLYKLD
  PDRQYRVMRAVPLEAVTGLSVTSGGDQLVVLHARGQDDLVVCLHRSRPPLDNRVGELVGV
  LAAHCQGEGRTLEVRVSDCIPLSHRGVRRLISVEPRPEQPEPDFRCARGSFTLLWPSR

• Sequence length: 1018

Pathways

KEGG Pathway

Motor proteins

Pathogenic Escherichia coli infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (6)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	31043756, 33686288	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER	—	GWAS catalog	31043756	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	33686288	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER-BIPOLAR TYPE	—	GWAS catalog	31043756	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	29924316	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (13)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	35425695	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34961566	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	11669217, 11929796, 12601144, 18316730, 7727778	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	20653428		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12869497, 15051765, 16322791	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	12234166, 12355426, 12601144, 15051765, 16399573	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16399573	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	20071660	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12601144, 23079962	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31148369		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31148369		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	8260714	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20960509	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MYO1H 2 shared pathwaysMotor proteins, Pathogenic Escherichia coli infection Related via 2 shared pathways including Motor proteins, Pathogenic Escherichia coli infection. MYO1B 2 shared pathwaysMotor proteins, Pathogenic Escherichia coli infection Related via 2 shared pathways including Motor proteins, Pathogenic Escherichia coli infection. MYO1F 2 shared pathwaysMotor proteins, Pathogenic Escherichia coli infection Related via 2 shared pathways including Motor proteins, Pathogenic Escherichia coli infection. MYO1A 2 shared pathwaysMotor proteins, Pathogenic Escherichia coli infection Related via 2 shared pathways including Motor proteins, Pathogenic Escherichia coli infection. MYO1D 2 shared pathwaysMotor proteins, Pathogenic Escherichia coli infection Related via 2 shared pathways including Motor proteins, Pathogenic Escherichia coli infection.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MYO1H	0	[]	2	["Motor proteins","Pathogenic Escherichia coli infection"]	0	[]
MYO1B	0	[]	2	["Motor proteins","Pathogenic Escherichia coli infection"]	0	[]
MYO1F	0	[]	2	["Motor proteins","Pathogenic Escherichia coli infection"]	0	[]
MYO1A	0	[]	2	["Motor proteins","Pathogenic Escherichia coli infection"]	0	[]
MYO1D	0	[]	2	["Motor proteins","Pathogenic Escherichia coli infection"]	0	[]

Diseases Linked via Similar Genes

Insomnia Linked via 2 of 5 related genesMYO1H, MYO1A Migraine Linked via 2 of 5 related genesMYO1H, MYO1A Pancreatic cancer Linked via 2 of 5 related genesMYO1B, MYO1D Hypertension Linked via 2 of 5 related genesMYO1B, MYO1D Metabolic syndrome Linked via 2 of 5 related genesMYO1F, MYO1D

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Insomnia	2	["MYO1H","MYO1A"]
Migraine	2	["MYO1H","MYO1A"]
Pancreatic cancer	2	["MYO1B","MYO1D"]
Hypertension	2	["MYO1B","MYO1D"]
Metabolic syndrome	2	["MYO1F","MYO1D"]