MYL6 (myosin light chain 6)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4637
• Gene name: Myosin light chain 6
• Gene symbol: MYL6
• Synonyms (NCBI Gene): ESMLC, LC17, LC17-GI, LC17-NM, LC17A, LC17B, MLC-3, MLC1SM, MLC3NM, MLC3SM
• Chromosome: 12
• Chromosome location: 12q13.2
• Summary: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain that is expressed in smoo

miRNA Show/Hide all (165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049263	hsa-miR-92a-3p	CLASH	23622248
MIRT044318	hsa-miR-106b-5p	CLASH	23622248
MIRT035801	hsa-miR-1910-5p	CLASH	23622248
MIRT1168607	hsa-miR-124	CLIP-seq
MIRT1168608	hsa-miR-3150a-3p	CLIP-seq
MIRT1168609	hsa-miR-3153	CLIP-seq
MIRT1168610	hsa-miR-3175	CLIP-seq
MIRT1168611	hsa-miR-326	CLIP-seq
MIRT1168612	hsa-miR-330-5p	CLIP-seq
MIRT1168613	hsa-miR-3622a-5p	CLIP-seq
MIRT1168614	hsa-miR-377	CLIP-seq
MIRT1168615	hsa-miR-4426	CLIP-seq
MIRT1168616	hsa-miR-4463	CLIP-seq
MIRT1168617	hsa-miR-4470	CLIP-seq
MIRT1168618	hsa-miR-4522	CLIP-seq
MIRT1168619	hsa-miR-4646-5p	CLIP-seq
MIRT1168620	hsa-miR-4647	CLIP-seq
MIRT1168621	hsa-miR-4662b	CLIP-seq
MIRT1168622	hsa-miR-4667-5p	CLIP-seq
MIRT1168623	hsa-miR-4668-5p	CLIP-seq
MIRT1168624	hsa-miR-4700-5p	CLIP-seq
MIRT1168625	hsa-miR-4747-5p	CLIP-seq
MIRT1168626	hsa-miR-493	CLIP-seq
MIRT1168627	hsa-miR-506	CLIP-seq
MIRT1168628	hsa-miR-548al	CLIP-seq
MIRT1168629	hsa-miR-548an	CLIP-seq
MIRT1168630	hsa-miR-564	CLIP-seq
MIRT1168631	hsa-miR-637	CLIP-seq
MIRT1168632	hsa-miR-939	CLIP-seq
MIRT1168607	hsa-miR-124	CLIP-seq
MIRT1168633	hsa-miR-3135	CLIP-seq
MIRT1168608	hsa-miR-3150a-3p	CLIP-seq
MIRT1168609	hsa-miR-3153	CLIP-seq
MIRT1168610	hsa-miR-3175	CLIP-seq
MIRT1168611	hsa-miR-326	CLIP-seq
MIRT1168612	hsa-miR-330-5p	CLIP-seq
MIRT1168613	hsa-miR-3622a-5p	CLIP-seq
MIRT1168614	hsa-miR-377	CLIP-seq
MIRT1168615	hsa-miR-4426	CLIP-seq
MIRT1168616	hsa-miR-4463	CLIP-seq
MIRT1168617	hsa-miR-4470	CLIP-seq
MIRT1168618	hsa-miR-4522	CLIP-seq
MIRT1168620	hsa-miR-4647	CLIP-seq
MIRT1168621	hsa-miR-4662b	CLIP-seq
MIRT1168622	hsa-miR-4667-5p	CLIP-seq
MIRT1168623	hsa-miR-4668-5p	CLIP-seq
MIRT1168624	hsa-miR-4700-5p	CLIP-seq
MIRT1168627	hsa-miR-506	CLIP-seq
MIRT1168628	hsa-miR-548al	CLIP-seq
MIRT1168629	hsa-miR-548an	CLIP-seq
MIRT1168630	hsa-miR-564	CLIP-seq
MIRT1168634	hsa-miR-628-5p	CLIP-seq
MIRT1168631	hsa-miR-637	CLIP-seq
MIRT1168632	hsa-miR-939	CLIP-seq
MIRT1551513	hsa-miR-3189-5p	CLIP-seq
MIRT1168634	hsa-miR-628-5p	CLIP-seq
MIRT1168609	hsa-miR-3153	CLIP-seq
MIRT1168615	hsa-miR-4426	CLIP-seq
MIRT1168617	hsa-miR-4470	CLIP-seq
MIRT1168620	hsa-miR-4647	CLIP-seq
MIRT1168621	hsa-miR-4662b	CLIP-seq
MIRT1168623	hsa-miR-4668-5p	CLIP-seq
MIRT1168628	hsa-miR-548al	CLIP-seq
MIRT1168634	hsa-miR-628-5p	CLIP-seq
MIRT2048529	hsa-miR-1257	CLIP-seq
MIRT1168608	hsa-miR-3150a-3p	CLIP-seq
MIRT1168610	hsa-miR-3175	CLIP-seq
MIRT1168611	hsa-miR-326	CLIP-seq
MIRT1168612	hsa-miR-330-5p	CLIP-seq
MIRT1168613	hsa-miR-3622a-5p	CLIP-seq
MIRT1168616	hsa-miR-4463	CLIP-seq
MIRT1168618	hsa-miR-4522	CLIP-seq
MIRT1168619	hsa-miR-4646-5p	CLIP-seq
MIRT1168622	hsa-miR-4667-5p	CLIP-seq
MIRT1168624	hsa-miR-4700-5p	CLIP-seq
MIRT1168625	hsa-miR-4747-5p	CLIP-seq
MIRT1168626	hsa-miR-493	CLIP-seq
MIRT1168630	hsa-miR-564	CLIP-seq
MIRT1168631	hsa-miR-637	CLIP-seq
MIRT1168632	hsa-miR-939	CLIP-seq
MIRT1168607	hsa-miR-124	CLIP-seq
MIRT1168633	hsa-miR-3135	CLIP-seq
MIRT1168608	hsa-miR-3150a-3p	CLIP-seq
MIRT1168609	hsa-miR-3153	CLIP-seq
MIRT1168610	hsa-miR-3175	CLIP-seq
MIRT1168611	hsa-miR-326	CLIP-seq
MIRT1168612	hsa-miR-330-5p	CLIP-seq
MIRT1168613	hsa-miR-3622a-5p	CLIP-seq
MIRT1168614	hsa-miR-377	CLIP-seq
MIRT2277399	hsa-miR-4329	CLIP-seq
MIRT1168615	hsa-miR-4426	CLIP-seq
MIRT1168616	hsa-miR-4463	CLIP-seq
MIRT1168617	hsa-miR-4470	CLIP-seq
MIRT1168618	hsa-miR-4522	CLIP-seq
MIRT1168619	hsa-miR-4646-5p	CLIP-seq
MIRT1168620	hsa-miR-4647	CLIP-seq
MIRT1168621	hsa-miR-4662b	CLIP-seq
MIRT2277400	hsa-miR-4663	CLIP-seq
MIRT1168622	hsa-miR-4667-5p	CLIP-seq
MIRT1168623	hsa-miR-4668-5p	CLIP-seq
MIRT1168624	hsa-miR-4700-5p	CLIP-seq
MIRT1168625	hsa-miR-4747-5p	CLIP-seq
MIRT1168626	hsa-miR-493	CLIP-seq
MIRT1168627	hsa-miR-506	CLIP-seq
MIRT1168628	hsa-miR-548al	CLIP-seq
MIRT1168629	hsa-miR-548an	CLIP-seq
MIRT1168630	hsa-miR-564	CLIP-seq
MIRT1168634	hsa-miR-628-5p	CLIP-seq
MIRT1168631	hsa-miR-637	CLIP-seq
MIRT1168632	hsa-miR-939	CLIP-seq
MIRT2048529	hsa-miR-1257	CLIP-seq
MIRT1168633	hsa-miR-3135	CLIP-seq
MIRT1168609	hsa-miR-3153	CLIP-seq
MIRT1168615	hsa-miR-4426	CLIP-seq
MIRT1168617	hsa-miR-4470	CLIP-seq
MIRT1168620	hsa-miR-4647	CLIP-seq
MIRT1168621	hsa-miR-4662b	CLIP-seq
MIRT2277400	hsa-miR-4663	CLIP-seq
MIRT1168623	hsa-miR-4668-5p	CLIP-seq
MIRT2431318	hsa-miR-4728-3p	CLIP-seq
MIRT1168628	hsa-miR-548al	CLIP-seq
MIRT1168634	hsa-miR-628-5p	CLIP-seq
MIRT1168633	hsa-miR-3135	CLIP-seq
MIRT1168607	hsa-miR-124	CLIP-seq
MIRT1168633	hsa-miR-3135	CLIP-seq
MIRT1168608	hsa-miR-3150a-3p	CLIP-seq
MIRT1168609	hsa-miR-3153	CLIP-seq
MIRT1168610	hsa-miR-3175	CLIP-seq
MIRT1168611	hsa-miR-326	CLIP-seq
MIRT1168612	hsa-miR-330-5p	CLIP-seq
MIRT1168613	hsa-miR-3622a-5p	CLIP-seq
MIRT1168614	hsa-miR-377	CLIP-seq
MIRT1168616	hsa-miR-4463	CLIP-seq
MIRT1168618	hsa-miR-4522	CLIP-seq
MIRT1168619	hsa-miR-4646-5p	CLIP-seq
MIRT1168622	hsa-miR-4667-5p	CLIP-seq
MIRT1168624	hsa-miR-4700-5p	CLIP-seq
MIRT1168625	hsa-miR-4747-5p	CLIP-seq
MIRT1168626	hsa-miR-493	CLIP-seq
MIRT1168627	hsa-miR-506	CLIP-seq
MIRT1168629	hsa-miR-548an	CLIP-seq
MIRT1168630	hsa-miR-564	CLIP-seq
MIRT1168631	hsa-miR-637	CLIP-seq
MIRT1168632	hsa-miR-939	CLIP-seq
MIRT1168607	hsa-miR-124	CLIP-seq
MIRT1168633	hsa-miR-3135	CLIP-seq
MIRT1168608	hsa-miR-3150a-3p	CLIP-seq
MIRT1168609	hsa-miR-3153	CLIP-seq
MIRT1168610	hsa-miR-3175	CLIP-seq
MIRT1168611	hsa-miR-326	CLIP-seq
MIRT1168612	hsa-miR-330-5p	CLIP-seq
MIRT1168613	hsa-miR-3622a-5p	CLIP-seq
MIRT1168614	hsa-miR-377	CLIP-seq
MIRT1168616	hsa-miR-4463	CLIP-seq
MIRT1168618	hsa-miR-4522	CLIP-seq
MIRT1168619	hsa-miR-4646-5p	CLIP-seq
MIRT1168622	hsa-miR-4667-5p	CLIP-seq
MIRT1168624	hsa-miR-4700-5p	CLIP-seq
MIRT1168625	hsa-miR-4747-5p	CLIP-seq
MIRT1168626	hsa-miR-493	CLIP-seq
MIRT1168627	hsa-miR-506	CLIP-seq
MIRT1168629	hsa-miR-548an	CLIP-seq
MIRT1168630	hsa-miR-564	CLIP-seq
MIRT1168631	hsa-miR-637	CLIP-seq
MIRT1168632	hsa-miR-939	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000146	Function	Microfilament motor activity	ISS
GO:0003774	Function	Cytoskeletal motor activity	TAS	2304459
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	16189514, 21182205, 21217774, 25416956, 31515488, 32296183
GO:0005829	Component	Cytosol	TAS
GO:0005903	Component	Brush border	IDA	22114352
GO:0006936	Process	Muscle contraction	IEA
GO:0006936	Process	Muscle contraction	TAS	2304459
GO:0007519	Process	Skeletal muscle tissue development	TAS	2304459
GO:0008307	Function	Structural constituent of muscle	IBA
GO:0008307	Function	Structural constituent of muscle	IDA	16953301
GO:0016020	Component	Membrane	HDA	19946888
GO:0016459	Component	Myosin complex	IEA
GO:0016459	Component	Myosin complex	TAS	2304459
GO:0016460	Component	Myosin II complex	IBA
GO:0016461	Component	Unconventional myosin complex	IEA
GO:0016461	Component	Unconventional myosin complex	TAS	2304459
GO:0030049	Process	Muscle filament sliding	TAS	2304459
GO:0031982	Component	Vesicle	HDA	19190083
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145

Other IDs

• MIM: 609931
• HGNC: 7587
• e!Ensembl: ENSG00000092841

Protein

• UniProt ID: P60660
• Protein name: Myosin light polypeptide 6 (17 kDa myosin light chain) (LC17) (Myosin light chain 3) (MLC-3) (Myosin light chain alkali 3) (Myosin light chain A3) (Smooth muscle and nonmuscle myosin light chain alkali 6)
• Protein function: Regulatory light chain of myosin. Does not bind calcium.
• Sequence:

  MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEM
  NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKM
  TEEEVEMLVAGHEDSNGCINYEAFVRHILSG

• Sequence length: 151

Pathways

KEGG Pathway	Reactome Pathway
Vascular smooth muscle contraction	Smooth Muscle Contraction
Tight junction	RHO GTPases activate PAKs
Motor proteins
Oxytocin signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	23933528	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	9748578	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36595475	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39519300	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MYL6B 5 shared pathwaysVascular smooth muscle contraction, Tight junction, Motor proteins, Oxytocin signaling pathway, Smooth Muscle Contraction Related via 5 shared pathways including Vascular smooth muscle contraction, Tight junction. MYH11 5 shared pathwaysVascular smooth muscle contraction, Tight junction, Motor proteins, Smooth Muscle Contraction, RHO GTPases activate PAKs Related via 5 shared pathways including Vascular smooth muscle contraction, Tight junction. ACTG2 3 shared pathwaysVascular smooth muscle contraction, Motor proteins, Smooth Muscle Contraction Related via 3 shared pathways including Vascular smooth muscle contraction, Motor proteins. MYH10 4 shared pathwaysVascular smooth muscle contraction, Tight junction, Motor proteins, RHO GTPases activate PAKs Related via 4 shared pathways including Vascular smooth muscle contraction, Tight junction. MYH14 4 shared pathwaysVascular smooth muscle contraction, Tight junction, Motor proteins, RHO GTPases activate PAKs Related via 4 shared pathways including Vascular smooth muscle contraction, Tight junction.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MYL6B	0	[]	5	["Vascular smooth muscle contraction","Tight junction","Motor proteins","Oxytocin signaling pathway","Smooth Muscle Contraction"]	0	[]
MYH11	0	[]	5	["Vascular smooth muscle contraction","Tight junction","Motor proteins","Smooth Muscle Contraction","RHO GTPases activate PAKs"]	0	[]
ACTG2	0	[]	3	["Vascular smooth muscle contraction","Motor proteins","Smooth Muscle Contraction"]	0	[]
MYH10	0	[]	4	["Vascular smooth muscle contraction","Tight junction","Motor proteins","RHO GTPases activate PAKs"]	0	[]
MYH14	0	[]	4	["Vascular smooth muscle contraction","Tight junction","Motor proteins","RHO GTPases activate PAKs"]	0	[]

Diseases Linked via Similar Genes

Intestinal pseudo-obstruction Linked via 2 of 5 related genesMYH11, ACTG2 Megacystis microcolon intestinal hypoperistalsis syndrome Linked via 2 of 5 related genesMYH11, ACTG2 Visceral myopathy Linked via 2 of 5 related genesMYH11, ACTG2 Aortic aneurysm Linked via 1 of 5 related genesMYH11 Atrial fibrillation Linked via 1 of 5 related genesMYH11

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Intestinal pseudo-obstruction	2	["MYH11","ACTG2"]
Megacystis microcolon intestinal hypoperistalsis syndrome	2	["MYH11","ACTG2"]
Visceral myopathy	2	["MYH11","ACTG2"]
Aortic aneurysm	1	["MYH11"]
Atrial fibrillation	1	["MYH11"]