MYH9 (myosin heavy chain 9)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4627
• Gene name: Myosin heavy chain 9
• Gene symbol: MYH9
• Synonyms (NCBI Gene): BDPLT6, DFNA17, EPSTS, FTNS, MATINS, MHA, NMHC-II-A, NMMHC-IIA, NMMHCA
• Chromosome: 22
• Chromosome location: 22q12.3
• Summary: This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain whic

SNPs Show/Hide all (38)

SNP ID	Visualize variation	Clinical significance	Consequence
rs34292387	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity, likely-benign	Coding sequence variant, missense variant
rs80338826	G>A,T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs80338827	C>T	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs80338828	C>T	Pathogenic	Coding sequence variant, missense variant
rs80338829	G>A	Pathogenic	Coding sequence variant, missense variant
rs80338830	C>A	Pathogenic	Coding sequence variant, missense variant
rs80338831	C>A,G,T	Pathogenic	Coding sequence variant, missense variant
rs80338834	C>T	Pathogenic	Coding sequence variant, missense variant
rs80338835	G>A	Pathogenic	Stop gained, coding sequence variant
rs121913655	G>A,C	Pathogenic	Coding sequence variant, synonymous variant, missense variant
rs121913656	G>A	Pathogenic	Coding sequence variant, missense variant
rs121913657	G>A	Pathogenic	Coding sequence variant, missense variant
rs139134727	G>A,T	Likely-benign, benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, missense variant
rs140241271	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs144807538	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs151036570	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs374840260	G>A,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, synonymous variant, coding sequence variant
rs577429531	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs587776808	C>-	Pathogenic	Frameshift variant, coding sequence variant
rs727503284	C>A	Pathogenic	Coding sequence variant, missense variant
rs764139009	T>C	Pathogenic	Missense variant, coding sequence variant
rs797044804	T>A,C	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs867593888	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs876661302	GCCTGGAGCTCGGCGATCTGG>-,GCCTGGAGCTCGGCGATCTGGGCCTGGAGCTCGGCGATCTGG	Pathogenic	Inframe deletion, coding sequence variant, inframe insertion
rs1184544985	G>A	Pathogenic	Missense variant, coding sequence variant
rs1321659356	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1430793034	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1556642578	TA>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1603482650	C>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1603482652	T>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1603482653	AGGTCCCCGC>-	Pathogenic	Coding sequence variant, frameshift variant
rs1603483058	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1603483077	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1603483388	C>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1603484047	C>T	Pathogenic	Missense variant, coding sequence variant
rs1603484048	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1603484059	C>G	Pathogenic	Missense variant, coding sequence variant
rs1603484060	A>C	Likely-pathogenic	Missense variant, coding sequence variant

miRNA Show/Hide all (1174)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002579	hsa-miR-124-3p	Microarray	15685193
MIRT021471	hsa-miR-9-5p	Microarray	17612493
MIRT002579	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT002579	hsa-miR-124-3p	Microarray	15685193
MIRT049384	hsa-miR-92a-3p	CLASH	23622248
MIRT045466	hsa-miR-149-5p	CLASH	23622248
MIRT043426	hsa-miR-331-3p	CLASH	23622248
MIRT042922	hsa-miR-324-3p	CLASH	23622248
MIRT042190	hsa-miR-484	CLASH	23622248
MIRT042190	hsa-miR-484	CLASH	23622248
MIRT041494	hsa-miR-193b-3p	CLASH	23622248
MIRT041494	hsa-miR-193b-3p	CLASH	23622248
MIRT037181	hsa-miR-877-3p	CLASH	23622248
MIRT036109	hsa-miR-1296-5p	CLASH	23622248
MIRT053474	hsa-let-7f-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	21533124
MIRT701665	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT701664	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT701663	hsa-miR-940	HITS-CLIP	23313552
MIRT701662	hsa-miR-3929	HITS-CLIP	23313552
MIRT701661	hsa-miR-4419b	HITS-CLIP	23313552
MIRT701659	hsa-miR-4478	HITS-CLIP	23313552
MIRT701660	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT701658	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT701657	hsa-miR-15b-3p	HITS-CLIP	23313552
MIRT701656	hsa-miR-1827	HITS-CLIP	23313552
MIRT701655	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT701654	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT630385	hsa-miR-3689c	HITS-CLIP	23313552
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT701653	hsa-miR-1305	HITS-CLIP	23313552
MIRT701652	hsa-miR-665	HITS-CLIP	23313552
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630401	hsa-miR-4284	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT667326	hsa-miR-4310	HITS-CLIP	23824327
MIRT667325	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT667324	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT667323	hsa-miR-671-5p	HITS-CLIP	23824327
MIRT667322	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT667321	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT630401	hsa-miR-4284	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT630377	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630401	hsa-miR-4284	HITS-CLIP	23824327
MIRT630400	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT630377	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT608755	hsa-miR-106a-5p	HITS-CLIP	24906430
MIRT608754	hsa-miR-106b-5p	HITS-CLIP	24906430
MIRT608753	hsa-miR-17-5p	HITS-CLIP	24906430
MIRT608752	hsa-miR-20a-5p	HITS-CLIP	24906430
MIRT608751	hsa-miR-20b-5p	HITS-CLIP	24906430
MIRT608750	hsa-miR-519d-3p	HITS-CLIP	24906430
MIRT608749	hsa-miR-526b-3p	HITS-CLIP	24906430
MIRT608748	hsa-miR-93-5p	HITS-CLIP	24906430
MIRT608747	hsa-miR-302a-3p	HITS-CLIP	24906430
MIRT608746	hsa-miR-302b-3p	HITS-CLIP	24906430
MIRT608745	hsa-miR-302c-3p	HITS-CLIP	24906430
MIRT608744	hsa-miR-302d-3p	HITS-CLIP	24906430
MIRT608743	hsa-miR-302e	HITS-CLIP	24906430
MIRT608742	hsa-miR-372-3p	HITS-CLIP	24906430
MIRT608741	hsa-miR-373-3p	HITS-CLIP	24906430
MIRT608740	hsa-miR-520a-3p	HITS-CLIP	24906430
MIRT608739	hsa-miR-520b	HITS-CLIP	24906430
MIRT608738	hsa-miR-520c-3p	HITS-CLIP	24906430
MIRT608737	hsa-miR-520d-3p	HITS-CLIP	24906430
MIRT608736	hsa-miR-520e	HITS-CLIP	24906430
MIRT608735	hsa-miR-512-3p	HITS-CLIP	24906430
MIRT608734	hsa-miR-520g-3p	HITS-CLIP	24906430
MIRT608733	hsa-miR-520h	HITS-CLIP	24906430
MIRT608732	hsa-miR-186-3p	HITS-CLIP	24906430
MIRT608731	hsa-miR-150-5p	HITS-CLIP	24906430
MIRT608730	hsa-miR-4731-5p	HITS-CLIP	24906430
MIRT608729	hsa-miR-5589-5p	HITS-CLIP	24906430
MIRT448089	hsa-miR-490-3p	PAR-CLIP	22100165
MIRT448088	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT448087	hsa-miR-4453	PAR-CLIP	22100165
MIRT448086	hsa-miR-4538	PAR-CLIP	22100165
MIRT448084	hsa-miR-4329	PAR-CLIP	22100165
MIRT448085	hsa-miR-4524a-3p	PAR-CLIP	22100165
MIRT630389	hsa-miR-1273h-5p	PAR-CLIP	26701625
MIRT630389	hsa-miR-1273h-5p	PAR-CLIP	26701625
MIRT630389	hsa-miR-1273h-5p	PAR-CLIP	26701625
MIRT630389	hsa-miR-1273h-5p	PAR-CLIP	26701625
MIRT630398	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT630398	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT630398	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT630388	hsa-miR-30b-3p	PAR-CLIP	26701625
MIRT630388	hsa-miR-30b-3p	PAR-CLIP	26701625
MIRT630388	hsa-miR-30b-3p	PAR-CLIP	26701625
MIRT630388	hsa-miR-30b-3p	PAR-CLIP	26701625
MIRT630387	hsa-miR-3689a-3p	PAR-CLIP	26701625
MIRT630387	hsa-miR-3689a-3p	PAR-CLIP	26701625
MIRT630387	hsa-miR-3689a-3p	PAR-CLIP	26701625
MIRT630387	hsa-miR-3689a-3p	PAR-CLIP	26701625
MIRT630386	hsa-miR-3689b-3p	PAR-CLIP	26701625
MIRT630386	hsa-miR-3689b-3p	PAR-CLIP	26701625
MIRT630386	hsa-miR-3689b-3p	PAR-CLIP	26701625
MIRT630386	hsa-miR-3689b-3p	PAR-CLIP	26701625
MIRT630385	hsa-miR-3689c	PAR-CLIP	26701625
MIRT630385	hsa-miR-3689c	PAR-CLIP	26701625
MIRT630385	hsa-miR-3689c	PAR-CLIP	26701625
MIRT630385	hsa-miR-3689c	PAR-CLIP	26701625
MIRT630397	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT630397	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT630397	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT630383	hsa-miR-6779-5p	PAR-CLIP	26701625
MIRT630383	hsa-miR-6779-5p	PAR-CLIP	26701625
MIRT630383	hsa-miR-6779-5p	PAR-CLIP	26701625
MIRT630383	hsa-miR-6779-5p	PAR-CLIP	26701625
MIRT630384	hsa-miR-6780a-5p	PAR-CLIP	26701625
MIRT630384	hsa-miR-6780a-5p	PAR-CLIP	26701625
MIRT630384	hsa-miR-6780a-5p	PAR-CLIP	26701625
MIRT630384	hsa-miR-6780a-5p	PAR-CLIP	26701625
MIRT630396	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT630396	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT630396	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT630394	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT630394	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT630394	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT630394	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT630395	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT630395	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT630395	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT630399	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT630399	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT630399	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT630399	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT002579	hsa-miR-124-3p	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR, ELISA	32711535
MIRT002579	hsa-miR-124-3p	Luciferase reporter assay, Western blotting, qRT-PCR	33330445
MIRT701665	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT701664	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT701663	hsa-miR-940	HITS-CLIP	23313552
MIRT701662	hsa-miR-3929	HITS-CLIP	23313552
MIRT701661	hsa-miR-4419b	HITS-CLIP	23313552
MIRT701659	hsa-miR-4478	HITS-CLIP	23313552
MIRT701660	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT701658	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT701657	hsa-miR-15b-3p	HITS-CLIP	23313552
MIRT701656	hsa-miR-1827	HITS-CLIP	23313552
MIRT701655	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT701654	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23313552
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23313552
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23313552
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23313552
MIRT630385	hsa-miR-3689c	HITS-CLIP	23313552
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23313552
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23313552
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23313552
MIRT701653	hsa-miR-1305	HITS-CLIP	23313552
MIRT701652	hsa-miR-665	HITS-CLIP	23313552
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630401	hsa-miR-4284	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT667326	hsa-miR-4310	HITS-CLIP	23824327
MIRT667325	hsa-miR-7157-5p	HITS-CLIP	23824327
MIRT667324	hsa-miR-338-3p	HITS-CLIP	23824327
MIRT667323	hsa-miR-671-5p	HITS-CLIP	23824327
MIRT667322	hsa-miR-4747-5p	HITS-CLIP	23824327
MIRT667321	hsa-miR-5196-5p	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT630401	hsa-miR-4284	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT630377	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT630402	hsa-miR-4267	HITS-CLIP	23824327
MIRT021471	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT630401	hsa-miR-4284	HITS-CLIP	23824327
MIRT630400	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT630399	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT630398	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT630397	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT630396	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT630395	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT630394	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT630393	hsa-miR-7977	HITS-CLIP	23824327
MIRT630392	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT630391	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT630390	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT630389	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT630388	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT630387	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT630386	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT630385	hsa-miR-3689c	HITS-CLIP	23824327
MIRT630383	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT630384	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT630382	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT630381	hsa-miR-3122	HITS-CLIP	23824327
MIRT630380	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT630379	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT630378	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT630377	hsa-miR-6821-5p	HITS-CLIP	23824327
MIRT448089	hsa-miR-490-3p	PAR-CLIP	22100165
MIRT448088	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT448087	hsa-miR-4453	PAR-CLIP	22100165
MIRT448086	hsa-miR-4538	PAR-CLIP	22100165
MIRT448084	hsa-miR-4329	PAR-CLIP	22100165
MIRT448085	hsa-miR-4524a-3p	PAR-CLIP	22100165
MIRT1168326	hsa-miR-103a	CLIP-seq
MIRT1168327	hsa-miR-107	CLIP-seq
MIRT1168328	hsa-miR-1183	CLIP-seq
MIRT1168329	hsa-miR-1236	CLIP-seq
MIRT1168330	hsa-miR-124	CLIP-seq
MIRT1168331	hsa-miR-1248	CLIP-seq
MIRT1168332	hsa-miR-1254	CLIP-seq
MIRT1168333	hsa-miR-1256	CLIP-seq
MIRT1168334	hsa-miR-1258	CLIP-seq
MIRT1168335	hsa-miR-1264	CLIP-seq
MIRT1168336	hsa-miR-1291	CLIP-seq
MIRT1168337	hsa-miR-1301	CLIP-seq
MIRT1168338	hsa-miR-1302	CLIP-seq
MIRT1168339	hsa-miR-1321	CLIP-seq
MIRT1168340	hsa-miR-133a	CLIP-seq
MIRT1168341	hsa-miR-133b	CLIP-seq
MIRT1168342	hsa-miR-138	CLIP-seq
MIRT1168343	hsa-miR-140-5p	CLIP-seq
MIRT1168344	hsa-miR-142-3p	CLIP-seq
MIRT1168345	hsa-miR-146b-3p	CLIP-seq
MIRT1168346	hsa-miR-1538	CLIP-seq
MIRT1168347	hsa-miR-1909	CLIP-seq
MIRT1168348	hsa-miR-1910	CLIP-seq
MIRT1168349	hsa-miR-197	CLIP-seq
MIRT1168350	hsa-miR-2114	CLIP-seq
MIRT1168351	hsa-miR-2277-3p	CLIP-seq
MIRT1168352	hsa-miR-25	CLIP-seq
MIRT1168353	hsa-miR-2682	CLIP-seq
MIRT1168354	hsa-miR-27a	CLIP-seq
MIRT1168355	hsa-miR-27b	CLIP-seq
MIRT1168356	hsa-miR-296-5p	CLIP-seq
MIRT1168357	hsa-miR-300	CLIP-seq
MIRT1168358	hsa-miR-3065-5p	CLIP-seq
MIRT1168359	hsa-miR-3074-3p	CLIP-seq
MIRT1168360	hsa-miR-30a	CLIP-seq
MIRT1168361	hsa-miR-30b	CLIP-seq
MIRT1168362	hsa-miR-30c	CLIP-seq
MIRT1168363	hsa-miR-30d	CLIP-seq
MIRT1168364	hsa-miR-30e	CLIP-seq
MIRT1168365	hsa-miR-3116	CLIP-seq
MIRT1168366	hsa-miR-3120-3p	CLIP-seq
MIRT1168367	hsa-miR-3121-3p	CLIP-seq
MIRT1168368	hsa-miR-3121-5p	CLIP-seq
MIRT1168369	hsa-miR-3140-5p	CLIP-seq
MIRT1168370	hsa-miR-3147	CLIP-seq
MIRT1168371	hsa-miR-3148	CLIP-seq
MIRT1168372	hsa-miR-3150a-3p	CLIP-seq
MIRT1168373	hsa-miR-3163	CLIP-seq
MIRT1168374	hsa-miR-3173-3p	CLIP-seq
MIRT1168375	hsa-miR-3175	CLIP-seq
MIRT1168376	hsa-miR-3179	CLIP-seq
MIRT1168377	hsa-miR-3180	CLIP-seq
MIRT1168378	hsa-miR-3180-3p	CLIP-seq
MIRT1168379	hsa-miR-3181	CLIP-seq
MIRT1168380	hsa-miR-3185	CLIP-seq
MIRT1168381	hsa-miR-3191	CLIP-seq
MIRT1168382	hsa-miR-3192	CLIP-seq
MIRT1168383	hsa-miR-3196	CLIP-seq
MIRT1168384	hsa-miR-32	CLIP-seq
MIRT1168385	hsa-miR-3202	CLIP-seq
MIRT1168386	hsa-miR-339-5p	CLIP-seq
MIRT1168387	hsa-miR-34a	CLIP-seq
MIRT1168388	hsa-miR-34c-3p	CLIP-seq
MIRT1168389	hsa-miR-34c-5p	CLIP-seq
MIRT1168390	hsa-miR-3545-5p	CLIP-seq
MIRT1168391	hsa-miR-3607-3p	CLIP-seq
MIRT1168392	hsa-miR-3612	CLIP-seq
MIRT1168393	hsa-miR-361-5p	CLIP-seq
MIRT1168394	hsa-miR-3616-3p	CLIP-seq
MIRT1168395	hsa-miR-363	CLIP-seq
MIRT1168396	hsa-miR-3649	CLIP-seq
MIRT1168397	hsa-miR-3659	CLIP-seq
MIRT1168398	hsa-miR-3665	CLIP-seq
MIRT1168399	hsa-miR-3669	CLIP-seq
MIRT1168400	hsa-miR-367	CLIP-seq
MIRT1168401	hsa-miR-3672	CLIP-seq
MIRT1168402	hsa-miR-3674	CLIP-seq
MIRT1168403	hsa-miR-3680	CLIP-seq
MIRT1168404	hsa-miR-3686	CLIP-seq
MIRT1168405	hsa-miR-3688-5p	CLIP-seq
MIRT1168406	hsa-miR-3714	CLIP-seq
MIRT1168407	hsa-miR-381	CLIP-seq
MIRT1168408	hsa-miR-3909	CLIP-seq
MIRT1168409	hsa-miR-3910	CLIP-seq
MIRT1168410	hsa-miR-410	CLIP-seq
MIRT1168411	hsa-miR-411	CLIP-seq
MIRT1168412	hsa-miR-4254	CLIP-seq
MIRT1168413	hsa-miR-4264	CLIP-seq
MIRT1168414	hsa-miR-4270	CLIP-seq
MIRT1168415	hsa-miR-4274	CLIP-seq
MIRT1168416	hsa-miR-4281	CLIP-seq
MIRT1168417	hsa-miR-4283	CLIP-seq
MIRT1168418	hsa-miR-4297	CLIP-seq
MIRT1168419	hsa-miR-4298	CLIP-seq
MIRT1168420	hsa-miR-4300	CLIP-seq
MIRT1168421	hsa-miR-4303	CLIP-seq
MIRT1168422	hsa-miR-4314	CLIP-seq
MIRT1168423	hsa-miR-4325	CLIP-seq
MIRT1168424	hsa-miR-433	CLIP-seq
MIRT1168425	hsa-miR-4419a	CLIP-seq
MIRT1168426	hsa-miR-4421	CLIP-seq
MIRT1168427	hsa-miR-4425	CLIP-seq
MIRT1168428	hsa-miR-4432	CLIP-seq
MIRT1168429	hsa-miR-4434	CLIP-seq
MIRT1168430	hsa-miR-4436b-3p	CLIP-seq
MIRT1168431	hsa-miR-4441	CLIP-seq
MIRT1168432	hsa-miR-4447	CLIP-seq
MIRT1168433	hsa-miR-4452	CLIP-seq
MIRT1168434	hsa-miR-4456	CLIP-seq
MIRT1168435	hsa-miR-4459	CLIP-seq
MIRT1168436	hsa-miR-4460	CLIP-seq
MIRT1168437	hsa-miR-4468	CLIP-seq
MIRT1168438	hsa-miR-4472	CLIP-seq
MIRT1168439	hsa-miR-4487	CLIP-seq
MIRT1168440	hsa-miR-4488	CLIP-seq
MIRT1168441	hsa-miR-449a	CLIP-seq
MIRT1168442	hsa-miR-449b	CLIP-seq
MIRT1168443	hsa-miR-449c	CLIP-seq
MIRT1168444	hsa-miR-4504	CLIP-seq
MIRT1168445	hsa-miR-4510	CLIP-seq
MIRT1168446	hsa-miR-4516	CLIP-seq
MIRT1168447	hsa-miR-4639-5p	CLIP-seq
MIRT1168448	hsa-miR-4643	CLIP-seq
MIRT1168449	hsa-miR-4646-5p	CLIP-seq
MIRT1168450	hsa-miR-4660	CLIP-seq
MIRT1168451	hsa-miR-4666-3p	CLIP-seq
MIRT1168452	hsa-miR-4680-3p	CLIP-seq
MIRT1168453	hsa-miR-4693-5p	CLIP-seq
MIRT1168454	hsa-miR-4695-5p	CLIP-seq
MIRT1168455	hsa-miR-4697-5p	CLIP-seq
MIRT1168456	hsa-miR-4706	CLIP-seq
MIRT1168457	hsa-miR-4729	CLIP-seq
MIRT1168458	hsa-miR-4731-3p	CLIP-seq
MIRT1168459	hsa-miR-4734	CLIP-seq
MIRT1168460	hsa-miR-4739	CLIP-seq
MIRT1168461	hsa-miR-4745-3p	CLIP-seq
MIRT1168462	hsa-miR-4749-3p	CLIP-seq
MIRT1168463	hsa-miR-4749-5p	CLIP-seq
MIRT1168464	hsa-miR-4753-3p	CLIP-seq
MIRT1168465	hsa-miR-4756-5p	CLIP-seq
MIRT1168466	hsa-miR-4772-3p	CLIP-seq
MIRT1168467	hsa-miR-4779	CLIP-seq
MIRT1168468	hsa-miR-4786-3p	CLIP-seq
MIRT1168469	hsa-miR-4795-3p	CLIP-seq
MIRT1168470	hsa-miR-4799-5p	CLIP-seq
MIRT1168471	hsa-miR-4801	CLIP-seq
MIRT1168472	hsa-miR-483-3p	CLIP-seq
MIRT1168473	hsa-miR-485-5p	CLIP-seq
MIRT1168474	hsa-miR-491-5p	CLIP-seq
MIRT1168475	hsa-miR-492	CLIP-seq
MIRT1168476	hsa-miR-5047	CLIP-seq
MIRT1168477	hsa-miR-506	CLIP-seq
MIRT1168478	hsa-miR-513a-5p	CLIP-seq
MIRT1168479	hsa-miR-532-5p	CLIP-seq
MIRT1168480	hsa-miR-539	CLIP-seq
MIRT1168481	hsa-miR-542-3p	CLIP-seq
MIRT1168482	hsa-miR-545	CLIP-seq
MIRT1168483	hsa-miR-548an	CLIP-seq
MIRT1168484	hsa-miR-548u	CLIP-seq
MIRT1168485	hsa-miR-556-3p	CLIP-seq
MIRT1168486	hsa-miR-570	CLIP-seq
MIRT1168487	hsa-miR-590-3p	CLIP-seq
MIRT1168488	hsa-miR-593	CLIP-seq
MIRT1168489	hsa-miR-619	CLIP-seq
MIRT1168490	hsa-miR-622	CLIP-seq
MIRT1168491	hsa-miR-650	CLIP-seq
MIRT1168492	hsa-miR-657	CLIP-seq
MIRT1168493	hsa-miR-658	CLIP-seq
MIRT1168494	hsa-miR-661	CLIP-seq
MIRT1168495	hsa-miR-744	CLIP-seq
MIRT1168496	hsa-miR-758	CLIP-seq
MIRT1168497	hsa-miR-765	CLIP-seq
MIRT1168498	hsa-miR-9	CLIP-seq
MIRT1168499	hsa-miR-920	CLIP-seq
MIRT1168500	hsa-miR-92a	CLIP-seq
MIRT1168501	hsa-miR-92b	CLIP-seq
MIRT1168502	hsa-miR-939	CLIP-seq
MIRT1168503	hsa-miR-95	CLIP-seq
MIRT1168326	hsa-miR-103a	CLIP-seq
MIRT1551475	hsa-miR-105	CLIP-seq
MIRT1168327	hsa-miR-107	CLIP-seq
MIRT1551476	hsa-miR-1224-5p	CLIP-seq
MIRT1168329	hsa-miR-1236	CLIP-seq
MIRT1551477	hsa-miR-1237	CLIP-seq
MIRT1168331	hsa-miR-1248	CLIP-seq
MIRT1168334	hsa-miR-1258	CLIP-seq
MIRT1551478	hsa-miR-1299	CLIP-seq
MIRT1168337	hsa-miR-1301	CLIP-seq
MIRT1168338	hsa-miR-1302	CLIP-seq
MIRT1168339	hsa-miR-1321	CLIP-seq
MIRT1168342	hsa-miR-138	CLIP-seq
MIRT1168345	hsa-miR-146b-3p	CLIP-seq
MIRT1168347	hsa-miR-1909	CLIP-seq
MIRT1551479	hsa-miR-1915	CLIP-seq
MIRT1168349	hsa-miR-197	CLIP-seq
MIRT1168350	hsa-miR-2114	CLIP-seq
MIRT1168351	hsa-miR-2277-3p	CLIP-seq
MIRT1168353	hsa-miR-2682	CLIP-seq
MIRT1551480	hsa-miR-2861	CLIP-seq
MIRT1168357	hsa-miR-300	CLIP-seq
MIRT1168359	hsa-miR-3074-3p	CLIP-seq
MIRT1168366	hsa-miR-3120-3p	CLIP-seq
MIRT1551481	hsa-miR-3125	CLIP-seq
MIRT1168369	hsa-miR-3140-5p	CLIP-seq
MIRT1168372	hsa-miR-3150a-3p	CLIP-seq
MIRT1168374	hsa-miR-3173-3p	CLIP-seq
MIRT1551482	hsa-miR-3173-5p	CLIP-seq
MIRT1168375	hsa-miR-3175	CLIP-seq
MIRT1551483	hsa-miR-3176	CLIP-seq
MIRT1168376	hsa-miR-3179	CLIP-seq
MIRT1168385	hsa-miR-3202	CLIP-seq
MIRT1168387	hsa-miR-34a	CLIP-seq
MIRT1168388	hsa-miR-34c-3p	CLIP-seq
MIRT1168389	hsa-miR-34c-5p	CLIP-seq
MIRT1168392	hsa-miR-3612	CLIP-seq
MIRT1168396	hsa-miR-3649	CLIP-seq
MIRT1551484	hsa-miR-365	CLIP-seq
MIRT1168402	hsa-miR-3674	CLIP-seq
MIRT1168406	hsa-miR-3714	CLIP-seq
MIRT1551485	hsa-miR-378	CLIP-seq
MIRT1551486	hsa-miR-378b	CLIP-seq
MIRT1551487	hsa-miR-378c	CLIP-seq
MIRT1551488	hsa-miR-378d	CLIP-seq
MIRT1551489	hsa-miR-378e	CLIP-seq
MIRT1551490	hsa-miR-378f	CLIP-seq
MIRT1551491	hsa-miR-378h	CLIP-seq
MIRT1551492	hsa-miR-378i	CLIP-seq
MIRT1168407	hsa-miR-381	CLIP-seq
MIRT1551493	hsa-miR-3916	CLIP-seq
MIRT1551494	hsa-miR-3918	CLIP-seq
MIRT1551495	hsa-miR-3922-3p	CLIP-seq
MIRT1551496	hsa-miR-422a	CLIP-seq
MIRT1551497	hsa-miR-4268	CLIP-seq
MIRT1168414	hsa-miR-4270	CLIP-seq
MIRT1168419	hsa-miR-4298	CLIP-seq
MIRT1168420	hsa-miR-4300	CLIP-seq
MIRT1168424	hsa-miR-433	CLIP-seq
MIRT1168425	hsa-miR-4419a	CLIP-seq
MIRT1168431	hsa-miR-4441	CLIP-seq
MIRT1168432	hsa-miR-4447	CLIP-seq
MIRT1551498	hsa-miR-4448	CLIP-seq
MIRT1168433	hsa-miR-4452	CLIP-seq
MIRT1168434	hsa-miR-4456	CLIP-seq
MIRT1168435	hsa-miR-4459	CLIP-seq
MIRT1168438	hsa-miR-4472	CLIP-seq
MIRT1168439	hsa-miR-4487	CLIP-seq
MIRT1168440	hsa-miR-4488	CLIP-seq
MIRT1551499	hsa-miR-4494	CLIP-seq
MIRT1168441	hsa-miR-449a	CLIP-seq
MIRT1168442	hsa-miR-449b	CLIP-seq
MIRT1168443	hsa-miR-449c	CLIP-seq
MIRT1168445	hsa-miR-4510	CLIP-seq
MIRT1551500	hsa-miR-4512	CLIP-seq
MIRT1551501	hsa-miR-4532	CLIP-seq
MIRT1551502	hsa-miR-4533	CLIP-seq
MIRT1551503	hsa-miR-4638-3p	CLIP-seq
MIRT1168450	hsa-miR-4660	CLIP-seq
MIRT1168451	hsa-miR-4666-3p	CLIP-seq
MIRT1168452	hsa-miR-4680-3p	CLIP-seq
MIRT1551504	hsa-miR-4685-5p	CLIP-seq
MIRT1168455	hsa-miR-4697-5p	CLIP-seq
MIRT1551505	hsa-miR-4707-5p	CLIP-seq
MIRT1168460	hsa-miR-4739	CLIP-seq
MIRT1168462	hsa-miR-4749-3p	CLIP-seq
MIRT1551506	hsa-miR-4751	CLIP-seq
MIRT1168465	hsa-miR-4756-5p	CLIP-seq
MIRT1551507	hsa-miR-4763-5p	CLIP-seq
MIRT1551508	hsa-miR-4782-5p	CLIP-seq
MIRT1168468	hsa-miR-4786-3p	CLIP-seq
MIRT1168470	hsa-miR-4799-5p	CLIP-seq
MIRT1168472	hsa-miR-483-3p	CLIP-seq
MIRT1168473	hsa-miR-485-5p	CLIP-seq
MIRT1168474	hsa-miR-491-5p	CLIP-seq
MIRT1168475	hsa-miR-492	CLIP-seq
MIRT1551509	hsa-miR-499a-5p	CLIP-seq
MIRT1168476	hsa-miR-5047	CLIP-seq
MIRT1551510	hsa-miR-516b	CLIP-seq
MIRT1168482	hsa-miR-545	CLIP-seq
MIRT1168483	hsa-miR-548an	CLIP-seq
MIRT1168491	hsa-miR-650	CLIP-seq
MIRT1168497	hsa-miR-765	CLIP-seq
MIRT1551511	hsa-miR-874	CLIP-seq
MIRT1168499	hsa-miR-920	CLIP-seq
MIRT1551512	hsa-miR-922	CLIP-seq
MIRT1168502	hsa-miR-939	CLIP-seq
MIRT1551475	hsa-miR-105	CLIP-seq
MIRT1168353	hsa-miR-2682	CLIP-seq
MIRT1168379	hsa-miR-3181	CLIP-seq
MIRT1168387	hsa-miR-34a	CLIP-seq
MIRT1168389	hsa-miR-34c-5p	CLIP-seq
MIRT1551484	hsa-miR-365	CLIP-seq
MIRT1168398	hsa-miR-3665	CLIP-seq
MIRT1168399	hsa-miR-3669	CLIP-seq
MIRT1168406	hsa-miR-3714	CLIP-seq
MIRT1168428	hsa-miR-4432	CLIP-seq
MIRT1168441	hsa-miR-449a	CLIP-seq
MIRT1168442	hsa-miR-449b	CLIP-seq
MIRT1168443	hsa-miR-449c	CLIP-seq
MIRT1168468	hsa-miR-4786-3p	CLIP-seq
MIRT1168480	hsa-miR-539	CLIP-seq
MIRT1168483	hsa-miR-548an	CLIP-seq
MIRT1168484	hsa-miR-548u	CLIP-seq
MIRT1168487	hsa-miR-590-3p	CLIP-seq
MIRT1168492	hsa-miR-657	CLIP-seq
MIRT1168503	hsa-miR-95	CLIP-seq
MIRT1168326	hsa-miR-103a	CLIP-seq
MIRT1551475	hsa-miR-105	CLIP-seq
MIRT1168327	hsa-miR-107	CLIP-seq
MIRT1168328	hsa-miR-1183	CLIP-seq
MIRT1551476	hsa-miR-1224-5p	CLIP-seq
MIRT1168329	hsa-miR-1236	CLIP-seq
MIRT1551477	hsa-miR-1237	CLIP-seq
MIRT1168330	hsa-miR-124	CLIP-seq
MIRT1168338	hsa-miR-1302	CLIP-seq
MIRT1168340	hsa-miR-133a	CLIP-seq
MIRT1168341	hsa-miR-133b	CLIP-seq
MIRT1168343	hsa-miR-140-5p	CLIP-seq
MIRT1168344	hsa-miR-142-3p	CLIP-seq
MIRT1168345	hsa-miR-146b-3p	CLIP-seq
MIRT2048522	hsa-miR-149	CLIP-seq
MIRT1168347	hsa-miR-1909	CLIP-seq
MIRT1168348	hsa-miR-1910	CLIP-seq
MIRT1168349	hsa-miR-197	CLIP-seq
MIRT1168350	hsa-miR-2114	CLIP-seq
MIRT1168351	hsa-miR-2277-3p	CLIP-seq
MIRT1168357	hsa-miR-300	CLIP-seq
MIRT2048523	hsa-miR-3064-5p	CLIP-seq
MIRT1168358	hsa-miR-3065-5p	CLIP-seq
MIRT1168366	hsa-miR-3120-3p	CLIP-seq
MIRT1168368	hsa-miR-3121-5p	CLIP-seq
MIRT1551481	hsa-miR-3125	CLIP-seq
MIRT1168369	hsa-miR-3140-5p	CLIP-seq
MIRT1168372	hsa-miR-3150a-3p	CLIP-seq
MIRT1168374	hsa-miR-3173-3p	CLIP-seq
MIRT1551482	hsa-miR-3173-5p	CLIP-seq
MIRT1168375	hsa-miR-3175	CLIP-seq
MIRT1168376	hsa-miR-3179	CLIP-seq
MIRT1168379	hsa-miR-3181	CLIP-seq
MIRT2048524	hsa-miR-3182	CLIP-seq
MIRT1168382	hsa-miR-3192	CLIP-seq
MIRT1168385	hsa-miR-3202	CLIP-seq
MIRT1168390	hsa-miR-3545-5p	CLIP-seq
MIRT2048525	hsa-miR-3614-3p	CLIP-seq
MIRT1168393	hsa-miR-361-5p	CLIP-seq
MIRT1168396	hsa-miR-3649	CLIP-seq
MIRT1551484	hsa-miR-365	CLIP-seq
MIRT1168398	hsa-miR-3665	CLIP-seq
MIRT1168402	hsa-miR-3674	CLIP-seq
MIRT1168403	hsa-miR-3680	CLIP-seq
MIRT1168405	hsa-miR-3688-5p	CLIP-seq
MIRT1168406	hsa-miR-3714	CLIP-seq
MIRT1168407	hsa-miR-381	CLIP-seq
MIRT1168408	hsa-miR-3909	CLIP-seq
MIRT1168409	hsa-miR-3910	CLIP-seq
MIRT1551493	hsa-miR-3916	CLIP-seq
MIRT1168410	hsa-miR-410	CLIP-seq
MIRT1168411	hsa-miR-411	CLIP-seq
MIRT2048526	hsa-miR-4290	CLIP-seq
MIRT1168419	hsa-miR-4298	CLIP-seq
MIRT1168420	hsa-miR-4300	CLIP-seq
MIRT1168421	hsa-miR-4303	CLIP-seq
MIRT1168425	hsa-miR-4419a	CLIP-seq
MIRT1168433	hsa-miR-4452	CLIP-seq
MIRT1168436	hsa-miR-4460	CLIP-seq
MIRT1168437	hsa-miR-4468	CLIP-seq
MIRT1168439	hsa-miR-4487	CLIP-seq
MIRT1551499	hsa-miR-4494	CLIP-seq
MIRT1168444	hsa-miR-4504	CLIP-seq
MIRT1168445	hsa-miR-4510	CLIP-seq
MIRT1551502	hsa-miR-4533	CLIP-seq
MIRT1168447	hsa-miR-4639-5p	CLIP-seq
MIRT1168448	hsa-miR-4643	CLIP-seq
MIRT1168452	hsa-miR-4680-3p	CLIP-seq
MIRT2048527	hsa-miR-4687-3p	CLIP-seq
MIRT1168453	hsa-miR-4693-5p	CLIP-seq
MIRT1168458	hsa-miR-4731-3p	CLIP-seq
MIRT1168462	hsa-miR-4749-3p	CLIP-seq
MIRT1551506	hsa-miR-4751	CLIP-seq
MIRT1168464	hsa-miR-4753-3p	CLIP-seq
MIRT1168466	hsa-miR-4772-3p	CLIP-seq
MIRT1168467	hsa-miR-4779	CLIP-seq
MIRT1168468	hsa-miR-4786-3p	CLIP-seq
MIRT2048528	hsa-miR-4794	CLIP-seq
MIRT1168469	hsa-miR-4795-3p	CLIP-seq
MIRT1168470	hsa-miR-4799-5p	CLIP-seq
MIRT1168471	hsa-miR-4801	CLIP-seq
MIRT1168472	hsa-miR-483-3p	CLIP-seq
MIRT1168475	hsa-miR-492	CLIP-seq
MIRT1551509	hsa-miR-499a-5p	CLIP-seq
MIRT1168477	hsa-miR-506	CLIP-seq
MIRT1168481	hsa-miR-542-3p	CLIP-seq
MIRT1168482	hsa-miR-545	CLIP-seq
MIRT1168483	hsa-miR-548an	CLIP-seq
MIRT1168488	hsa-miR-593	CLIP-seq
MIRT1168489	hsa-miR-619	CLIP-seq
MIRT1168492	hsa-miR-657	CLIP-seq
MIRT1168494	hsa-miR-661	CLIP-seq
MIRT1168496	hsa-miR-758	CLIP-seq
MIRT1551511	hsa-miR-874	CLIP-seq
MIRT1168498	hsa-miR-9	CLIP-seq
MIRT1168499	hsa-miR-920	CLIP-seq
MIRT1551512	hsa-miR-922	CLIP-seq
MIRT1168502	hsa-miR-939	CLIP-seq
MIRT1168326	hsa-miR-103a	CLIP-seq
MIRT1551475	hsa-miR-105	CLIP-seq
MIRT1168327	hsa-miR-107	CLIP-seq
MIRT1168328	hsa-miR-1183	CLIP-seq
MIRT1551477	hsa-miR-1237	CLIP-seq
MIRT1168330	hsa-miR-124	CLIP-seq
MIRT1168331	hsa-miR-1248	CLIP-seq
MIRT1168332	hsa-miR-1254	CLIP-seq
MIRT1168334	hsa-miR-1258	CLIP-seq
MIRT1168335	hsa-miR-1264	CLIP-seq
MIRT1168337	hsa-miR-1301	CLIP-seq
MIRT1168338	hsa-miR-1302	CLIP-seq
MIRT1168343	hsa-miR-140-5p	CLIP-seq
MIRT1168344	hsa-miR-142-3p	CLIP-seq
MIRT1168345	hsa-miR-146b-3p	CLIP-seq
MIRT1168347	hsa-miR-1909	CLIP-seq
MIRT1168348	hsa-miR-1910	CLIP-seq
MIRT1551479	hsa-miR-1915	CLIP-seq
MIRT1168349	hsa-miR-197	CLIP-seq
MIRT2277380	hsa-miR-199a-5p	CLIP-seq
MIRT2277381	hsa-miR-199b-5p	CLIP-seq
MIRT1168350	hsa-miR-2114	CLIP-seq
MIRT1168351	hsa-miR-2277-3p	CLIP-seq
MIRT1168354	hsa-miR-27a	CLIP-seq
MIRT1168355	hsa-miR-27b	CLIP-seq
MIRT1551480	hsa-miR-2861	CLIP-seq
MIRT1168357	hsa-miR-300	CLIP-seq
MIRT1168358	hsa-miR-3065-5p	CLIP-seq
MIRT1168359	hsa-miR-3074-3p	CLIP-seq
MIRT1168365	hsa-miR-3116	CLIP-seq
MIRT1168366	hsa-miR-3120-3p	CLIP-seq
MIRT1168368	hsa-miR-3121-5p	CLIP-seq
MIRT1551481	hsa-miR-3125	CLIP-seq
MIRT1168369	hsa-miR-3140-5p	CLIP-seq
MIRT1168372	hsa-miR-3150a-3p	CLIP-seq
MIRT1551482	hsa-miR-3173-5p	CLIP-seq
MIRT1168375	hsa-miR-3175	CLIP-seq
MIRT1551483	hsa-miR-3176	CLIP-seq
MIRT1168376	hsa-miR-3179	CLIP-seq
MIRT2277382	hsa-miR-3180-5p	CLIP-seq
MIRT1168379	hsa-miR-3181	CLIP-seq
MIRT2048524	hsa-miR-3182	CLIP-seq
MIRT1168380	hsa-miR-3185	CLIP-seq
MIRT1168382	hsa-miR-3192	CLIP-seq
MIRT1168385	hsa-miR-3202	CLIP-seq
MIRT1168388	hsa-miR-34c-3p	CLIP-seq
MIRT1168390	hsa-miR-3545-5p	CLIP-seq
MIRT1168392	hsa-miR-3612	CLIP-seq
MIRT2048525	hsa-miR-3614-3p	CLIP-seq
MIRT1168396	hsa-miR-3649	CLIP-seq
MIRT1551484	hsa-miR-365	CLIP-seq
MIRT1168398	hsa-miR-3665	CLIP-seq
MIRT1168402	hsa-miR-3674	CLIP-seq
MIRT1168403	hsa-miR-3680	CLIP-seq
MIRT1168405	hsa-miR-3688-5p	CLIP-seq
MIRT1168406	hsa-miR-3714	CLIP-seq
MIRT1168407	hsa-miR-381	CLIP-seq
MIRT1168409	hsa-miR-3910	CLIP-seq
MIRT1551493	hsa-miR-3916	CLIP-seq
MIRT1551494	hsa-miR-3918	CLIP-seq
MIRT1551495	hsa-miR-3922-3p	CLIP-seq
MIRT1168410	hsa-miR-410	CLIP-seq
MIRT1168411	hsa-miR-411	CLIP-seq
MIRT2277383	hsa-miR-4252	CLIP-seq
MIRT1168413	hsa-miR-4264	CLIP-seq
MIRT1168415	hsa-miR-4274	CLIP-seq
MIRT2277384	hsa-miR-4280	CLIP-seq
MIRT1168417	hsa-miR-4283	CLIP-seq
MIRT2048526	hsa-miR-4290	CLIP-seq
MIRT1168419	hsa-miR-4298	CLIP-seq
MIRT1168420	hsa-miR-4300	CLIP-seq
MIRT1168421	hsa-miR-4303	CLIP-seq
MIRT1168422	hsa-miR-4314	CLIP-seq
MIRT1168424	hsa-miR-433	CLIP-seq
MIRT1168425	hsa-miR-4419a	CLIP-seq
MIRT2277385	hsa-miR-4433	CLIP-seq
MIRT2277386	hsa-miR-4443	CLIP-seq
MIRT1168433	hsa-miR-4452	CLIP-seq
MIRT1168435	hsa-miR-4459	CLIP-seq
MIRT1168436	hsa-miR-4460	CLIP-seq
MIRT1168437	hsa-miR-4468	CLIP-seq
MIRT1168439	hsa-miR-4487	CLIP-seq
MIRT1551499	hsa-miR-4494	CLIP-seq
MIRT1168444	hsa-miR-4504	CLIP-seq
MIRT1168445	hsa-miR-4510	CLIP-seq
MIRT1551500	hsa-miR-4512	CLIP-seq
MIRT1551502	hsa-miR-4533	CLIP-seq
MIRT1168447	hsa-miR-4639-5p	CLIP-seq
MIRT1168448	hsa-miR-4643	CLIP-seq
MIRT1168449	hsa-miR-4646-5p	CLIP-seq
MIRT1168450	hsa-miR-4660	CLIP-seq
MIRT1168451	hsa-miR-4666-3p	CLIP-seq
MIRT1168452	hsa-miR-4680-3p	CLIP-seq
MIRT1551504	hsa-miR-4685-5p	CLIP-seq
MIRT2048527	hsa-miR-4687-3p	CLIP-seq
MIRT2277387	hsa-miR-4693-3p	CLIP-seq
MIRT1168454	hsa-miR-4695-5p	CLIP-seq
MIRT1168456	hsa-miR-4706	CLIP-seq
MIRT1168458	hsa-miR-4731-3p	CLIP-seq
MIRT1168459	hsa-miR-4734	CLIP-seq
MIRT1168462	hsa-miR-4749-3p	CLIP-seq
MIRT1168463	hsa-miR-4749-5p	CLIP-seq
MIRT1168466	hsa-miR-4772-3p	CLIP-seq
MIRT1168467	hsa-miR-4779	CLIP-seq
MIRT1168468	hsa-miR-4786-3p	CLIP-seq
MIRT1168469	hsa-miR-4795-3p	CLIP-seq
MIRT1168471	hsa-miR-4801	CLIP-seq
MIRT1168472	hsa-miR-483-3p	CLIP-seq
MIRT1168473	hsa-miR-485-5p	CLIP-seq
MIRT1168474	hsa-miR-491-5p	CLIP-seq
MIRT1168475	hsa-miR-492	CLIP-seq
MIRT1551509	hsa-miR-499a-5p	CLIP-seq
MIRT1168476	hsa-miR-5047	CLIP-seq
MIRT1168477	hsa-miR-506	CLIP-seq
MIRT1168478	hsa-miR-513a-5p	CLIP-seq
MIRT1168481	hsa-miR-542-3p	CLIP-seq
MIRT1168490	hsa-miR-622	CLIP-seq
MIRT1168491	hsa-miR-650	CLIP-seq
MIRT1168492	hsa-miR-657	CLIP-seq
MIRT1168494	hsa-miR-661	CLIP-seq
MIRT1168495	hsa-miR-744	CLIP-seq
MIRT1168496	hsa-miR-758	CLIP-seq
MIRT1168497	hsa-miR-765	CLIP-seq
MIRT1551511	hsa-miR-874	CLIP-seq
MIRT1168499	hsa-miR-920	CLIP-seq
MIRT1551512	hsa-miR-922	CLIP-seq
MIRT1168502	hsa-miR-939	CLIP-seq
MIRT1168503	hsa-miR-95	CLIP-seq
MIRT1168326	hsa-miR-103a	CLIP-seq
MIRT1168327	hsa-miR-107	CLIP-seq
MIRT1551476	hsa-miR-1224-5p	CLIP-seq
MIRT1168334	hsa-miR-1258	CLIP-seq
MIRT1168348	hsa-miR-1910	CLIP-seq
MIRT1168351	hsa-miR-2277-3p	CLIP-seq
MIRT1168357	hsa-miR-300	CLIP-seq
MIRT1168359	hsa-miR-3074-3p	CLIP-seq
MIRT1168366	hsa-miR-3120-3p	CLIP-seq
MIRT1168368	hsa-miR-3121-5p	CLIP-seq
MIRT1168369	hsa-miR-3140-5p	CLIP-seq
MIRT1168370	hsa-miR-3147	CLIP-seq
MIRT1168379	hsa-miR-3181	CLIP-seq
MIRT1168382	hsa-miR-3192	CLIP-seq
MIRT1168388	hsa-miR-34c-3p	CLIP-seq
MIRT1168392	hsa-miR-3612	CLIP-seq
MIRT1168396	hsa-miR-3649	CLIP-seq
MIRT1168398	hsa-miR-3665	CLIP-seq
MIRT1168402	hsa-miR-3674	CLIP-seq
MIRT1168403	hsa-miR-3680	CLIP-seq
MIRT1168406	hsa-miR-3714	CLIP-seq
MIRT1168407	hsa-miR-381	CLIP-seq
MIRT2277383	hsa-miR-4252	CLIP-seq
MIRT1168424	hsa-miR-433	CLIP-seq
MIRT1168427	hsa-miR-4425	CLIP-seq
MIRT1168429	hsa-miR-4434	CLIP-seq
MIRT1168433	hsa-miR-4452	CLIP-seq
MIRT1168444	hsa-miR-4504	CLIP-seq
MIRT1168446	hsa-miR-4516	CLIP-seq
MIRT1168452	hsa-miR-4680-3p	CLIP-seq
MIRT1551506	hsa-miR-4751	CLIP-seq
MIRT1168468	hsa-miR-4786-3p	CLIP-seq
MIRT1168472	hsa-miR-483-3p	CLIP-seq
MIRT1168475	hsa-miR-492	CLIP-seq
MIRT1168481	hsa-miR-542-3p	CLIP-seq
MIRT1168491	hsa-miR-650	CLIP-seq
MIRT1168492	hsa-miR-657	CLIP-seq
MIRT1168494	hsa-miR-661	CLIP-seq
MIRT1168496	hsa-miR-758	CLIP-seq
MIRT1168503	hsa-miR-95	CLIP-seq
MIRT1168330	hsa-miR-124	CLIP-seq
MIRT1168334	hsa-miR-1258	CLIP-seq
MIRT1168337	hsa-miR-1301	CLIP-seq
MIRT1168343	hsa-miR-140-5p	CLIP-seq
MIRT2277380	hsa-miR-199a-5p	CLIP-seq
MIRT2277381	hsa-miR-199b-5p	CLIP-seq
MIRT1168351	hsa-miR-2277-3p	CLIP-seq
MIRT1168357	hsa-miR-300	CLIP-seq
MIRT1168359	hsa-miR-3074-3p	CLIP-seq
MIRT1168369	hsa-miR-3140-5p	CLIP-seq
MIRT1168373	hsa-miR-3163	CLIP-seq
MIRT1168390	hsa-miR-3545-5p	CLIP-seq
MIRT1168396	hsa-miR-3649	CLIP-seq
MIRT1168402	hsa-miR-3674	CLIP-seq
MIRT1168406	hsa-miR-3714	CLIP-seq
MIRT1168407	hsa-miR-381	CLIP-seq
MIRT1168409	hsa-miR-3910	CLIP-seq
MIRT1168410	hsa-miR-410	CLIP-seq
MIRT2277384	hsa-miR-4280	CLIP-seq
MIRT1168433	hsa-miR-4452	CLIP-seq
MIRT1168436	hsa-miR-4460	CLIP-seq
MIRT1168447	hsa-miR-4639-5p	CLIP-seq
MIRT1168448	hsa-miR-4643	CLIP-seq
MIRT1168450	hsa-miR-4660	CLIP-seq
MIRT1168451	hsa-miR-4666-3p	CLIP-seq
MIRT1168452	hsa-miR-4680-3p	CLIP-seq
MIRT1168466	hsa-miR-4772-3p	CLIP-seq
MIRT1168469	hsa-miR-4795-3p	CLIP-seq
MIRT1168475	hsa-miR-492	CLIP-seq
MIRT1168476	hsa-miR-5047	CLIP-seq
MIRT1168477	hsa-miR-506	CLIP-seq
MIRT1168481	hsa-miR-542-3p	CLIP-seq
MIRT1168351	hsa-miR-2277-3p	CLIP-seq
MIRT1168354	hsa-miR-27a	CLIP-seq
MIRT1168355	hsa-miR-27b	CLIP-seq
MIRT1168372	hsa-miR-3150a-3p	CLIP-seq
MIRT1168375	hsa-miR-3175	CLIP-seq
MIRT1168377	hsa-miR-3180	CLIP-seq
MIRT1168378	hsa-miR-3180-3p	CLIP-seq
MIRT1168381	hsa-miR-3191	CLIP-seq
MIRT1168383	hsa-miR-3196	CLIP-seq
MIRT1168392	hsa-miR-3612	CLIP-seq
MIRT1168394	hsa-miR-3616-3p	CLIP-seq
MIRT1168412	hsa-miR-4254	CLIP-seq
MIRT1168415	hsa-miR-4274	CLIP-seq
MIRT1168430	hsa-miR-4436b-3p	CLIP-seq
MIRT1168435	hsa-miR-4459	CLIP-seq
MIRT1168454	hsa-miR-4695-5p	CLIP-seq
MIRT1168474	hsa-miR-491-5p	CLIP-seq
MIRT1168478	hsa-miR-513a-5p	CLIP-seq
MIRT1168489	hsa-miR-619	CLIP-seq
MIRT1168491	hsa-miR-650	CLIP-seq
MIRT1168493	hsa-miR-658	CLIP-seq
MIRT1168497	hsa-miR-765	CLIP-seq
MIRT1168502	hsa-miR-939	CLIP-seq
MIRT2454676	hsa-miR-1205	CLIP-seq
MIRT2454677	hsa-miR-1253	CLIP-seq
MIRT2454678	hsa-miR-1286	CLIP-seq
MIRT2454679	hsa-miR-3155	CLIP-seq
MIRT2454680	hsa-miR-3155b	CLIP-seq
MIRT1168373	hsa-miR-3163	CLIP-seq
MIRT1168374	hsa-miR-3173-3p	CLIP-seq
MIRT1168401	hsa-miR-3672	CLIP-seq
MIRT1168410	hsa-miR-410	CLIP-seq
MIRT1168425	hsa-miR-4419a	CLIP-seq
MIRT2277385	hsa-miR-4433	CLIP-seq
MIRT1168429	hsa-miR-4434	CLIP-seq
MIRT1168432	hsa-miR-4447	CLIP-seq
MIRT1168435	hsa-miR-4459	CLIP-seq
MIRT1168438	hsa-miR-4472	CLIP-seq
MIRT1168440	hsa-miR-4488	CLIP-seq
MIRT1168445	hsa-miR-4510	CLIP-seq
MIRT1168446	hsa-miR-4516	CLIP-seq
MIRT1168455	hsa-miR-4697-5p	CLIP-seq
MIRT1168467	hsa-miR-4779	CLIP-seq
MIRT1168469	hsa-miR-4795-3p	CLIP-seq
MIRT1168497	hsa-miR-765	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
USF1	Unknown	11467950
USF2	Unknown	11467950

Gene ontology (GO) Show/Hide all (124)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000146	Function	Microfilament motor activity	IBA
GO:0000146	Function	Microfilament motor activity	IDA	24072716
GO:0000146	Function	Microfilament motor activity	IDA	12237319, 15845534
GO:0000166	Function	Nucleotide binding	IEA
GO:0000212	Process	Meiotic spindle organization	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001525	Process	Angiogenesis	IDA	16403913
GO:0001618	Function	Virus receptor activity	IDA	20944748
GO:0001618	Function	Virus receptor activity	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001725	Component	Stress fiber	IDA	7699007, 14508515, 14706930, 15774463, 16403913
GO:0001725	Component	Stress fiber	IEA
GO:0001726	Component	Ruffle	IDA	16403913
GO:0001768	Process	Establishment of T cell polarity	IEA
GO:0001772	Component	Immunological synapse	IDA	15064761
GO:0001772	Component	Immunological synapse	IEA
GO:0001778	Process	Plasma membrane repair	IDA	27325790
GO:0001778	Process	Plasma membrane repair	IEA
GO:0001931	Component	Uropod	IDA	15064761
GO:0001931	Component	Uropod	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003774	Function	Cytoskeletal motor activity	IEA
GO:0003774	Function	Cytoskeletal motor activity	NAS	12421915
GO:0003779	Function	Actin binding	IDA	15065866
GO:0003779	Function	Actin binding	IEA
GO:0005178	Function	Integrin binding	IDA	10822899
GO:0005515	Function	Protein binding	IPI	2732579, 10822899, 12202484, 12421915, 12577067, 14508515, 14640694, 15171681, 15479433, 16186248, 16403913, 17925381, 18504258, 20421509, 20603131, 20936779, 22229724, 22460785, 22483112, 22693546, 23100250, 24189400, 27325790, 28228547, 31837246, 33961781, 34873039, 36217030, 3900
GO:0005516	Function	Calmodulin binding	IEA
GO:0005524	Function	ATP binding	IDA	15065866, 15845534
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	14508515
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	7699007, 22693546
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005819	Component	Spindle	IEA
GO:0005826	Component	Actomyosin contractile ring	IDA	11029059
GO:0005829	Component	Cytosol	IDA	14508515
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	16186248, 16403913
GO:0005886	Component	Plasma membrane	IEA
GO:0005903	Component	Brush border	IEA
GO:0005912	Component	Adherens junction	IEA
GO:0005925	Component	Focal adhesion	IEA
GO:0005925	Component	Focal adhesion	ISS
GO:0005938	Component	Cell cortex	IEA
GO:0006509	Process	Membrane protein ectodomain proteolysis	IDA	16186248
GO:0006911	Process	Phagocytosis, engulfment	IEA
GO:0006911	Process	Phagocytosis, engulfment	ISS
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	10822899
GO:0007520	Process	Myoblast fusion	IEA
GO:0008180	Component	COP9 signalosome	IDA	18850735
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IMP	11029059
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	15064761
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IDA	20944748
GO:0015031	Process	Protein transport	IMP	16403913
GO:0015629	Component	Actin cytoskeleton	IDA	15869600
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016459	Component	Myosin complex	IEA
GO:0016460	Component	Myosin II complex	IBA
GO:0016460	Component	Myosin II complex	IDA	24072716
GO:0016460	Component	Myosin II complex	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0019904	Function	Protein domain specific binding	IPI	23325791
GO:0030036	Process	Actin cytoskeleton organization	IMP	15869600
GO:0030048	Process	Actin filament-based movement	IDA	15845534
GO:0030048	Process	Actin filament-based movement	IDA	12237319
GO:0030220	Process	Platelet formation	IMP	12237319
GO:0030224	Process	Monocyte differentiation	IEP	1912569
GO:0030863	Component	Cortical cytoskeleton	IEA
GO:0031032	Process	Actomyosin structure organization	IDA	24072716
GO:0031252	Component	Cell leading edge	IDA	12421915
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031594	Component	Neuromuscular junction	IEA
GO:0032154	Component	Cleavage furrow	IDA	7699007, 14508515
GO:0032418	Process	Lysosome localization	IMP	2732579
GO:0032506	Process	Cytokinetic process	IMP	15774463
GO:0032796	Process	Uropod organization	IEA
GO:0032970	Process	Regulation of actin filament-based process	IEA
GO:0032982	Component	Myosin filament	IBA
GO:0032991	Component	Protein-containing complex	IDA	12421915
GO:0035987	Process	Endodermal cell differentiation	IEA
GO:0042641	Component	Actomyosin	IDA	24072716
GO:0042802	Function	Identical protein binding	IPI	22483112, 31837246
GO:0042803	Function	Protein homodimerization activity	IDA	12237319
GO:0043495	Function	Protein-membrane adaptor activity	IMP	16403913
GO:0043531	Function	ADP binding	IDA	15065866
GO:0043534	Process	Blood vessel endothelial cell migration	IMP	16403913
GO:0045055	Process	Regulated exocytosis	IMP	2732579
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046718	Process	Symbiont entry into host cell	IDA	20944748
GO:0048870	Process	Cell motility	IEA
GO:0050900	Process	Leukocyte migration	NAS	12421915
GO:0051015	Function	Actin filament binding	IBA
GO:0051015	Function	Actin filament binding	IDA	24072716
GO:0051015	Function	Actin filament binding	IDA	12237319, 14508515, 15845534
GO:0051015	Function	Actin filament binding	IEA
GO:0051015	Function	Actin filament binding	NAS	16403913
GO:0051295	Process	Establishment of meiotic spindle localization	IEA
GO:0060327	Process	Cytoplasmic actin-based contraction involved in cell motility	IEA
GO:0060471	Process	Cortical granule exocytosis	IEA
GO:0060471	Process	Cortical granule exocytosis	ISS
GO:0060473	Component	Cortical granule	IEA
GO:0060473	Component	Cortical granule	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 21362503, 23533145
GO:0070527	Process	Platelet aggregation	HMP	23382103
GO:0097513	Component	Myosin II filament	IDA	24072716
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0099512	Component	Supramolecular fiber	IEA
GO:1903919	Process	Negative regulation of actin filament severing	IEA
GO:1903919	Process	Negative regulation of actin filament severing	IMP	23325791
GO:1903919	Process	Negative regulation of actin filament severing	ISS
GO:1903923	Process	Positive regulation of protein processing in phagocytic vesicle	IEA
GO:1903923	Process	Positive regulation of protein processing in phagocytic vesicle	ISS
GO:1905684	Process	Regulation of plasma membrane repair	IMP	2732579

Other IDs

• MIM: 160775
• HGNC: 7579
• e!Ensembl: ENSG00000100345

Protein

• UniProt ID: P35579
• Protein name: Myosin-9 (Cellular myosin heavy chain, type A) (Myosin heavy chain 9) (Myosin heavy chain, non-muscle IIa) (Non-muscle myosin heavy chain A) (NMMHC-A) (Non-muscle myosin heavy chain IIa) (NMMHC II-a) (NMMHC-IIA)
• Protein function: Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Required for cortical actin clearance prior to oocyte exocytosis (By similarity). Promotes cell motility in conjunct
• PDB: 2LNK , 3ZWH , 4CFQ , 4CFR , 4ETO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00063	Myosin_head	83 → 764	Myosin head (motor domain)	Domain
  PF01576	Myosin_tail_1	841 → 1921	Myosin tail	Coiled-coil
  PF02736	Myosin_N	29 → 69	Myosin N-terminal SH3-like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: In the kidney, expressed in the glomeruli. Also expressed in leukocytes. {ECO:0000269|PubMed:11752022, ECO:0000269|PubMed:1912569}.
• Sequence:

  MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
  NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
  INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
  TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
  INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
  RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
  DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
  TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
  NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
  SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
  HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
  LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
  YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
  DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
  SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
  ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ
  KLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
  LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
  KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
  LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
  LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK
  FNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE
  NRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL
  ETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLE
  KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
  QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
  NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK
  DLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
  EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
  EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT
  VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQ
  YKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
  LRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE

• Sequence length: 1960

Pathways

KEGG Pathway	Reactome Pathway
Virion - Lassa virus and SFTS virus	Regulation of actin dynamics for phagocytic cup formation
Vascular smooth muscle contraction	RHO GTPases activate PAKs
Tight junction	CD163 mediating an anti-inflammatory response
Regulation of actin cytoskeleton	FCGR3A-mediated phagocytosis
Motor proteins
Cytoskeleton in muscle cells
Pathogenic Escherichia coli infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal Show/Hide Causal Diseases (10)
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Abnormal bleeding	Pathogenic	rs80338835, rs80338829	RCV001270545 RCV001270614	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autosomal dominant nonsyndromic hearing loss 17	Likely pathogenic; Pathogenic	rs727503284, rs80338835, rs80338834, rs80338829, rs80338826, rs80338828, rs80338831, rs121913657, rs990176353, rs2518022633, rs1184544985	RCV005025747 RCV002478429 RCV005031439 RCV002466403 RCV001542710 RCV002490369 RCV000015130 RCV002466404 RCV000477821 RCV004585119 RCV004585120 RCV002507333	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Deafness	Likely pathogenic; Pathogenic	rs80338834	RCV004798729	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hearing loss, autosomal recessive	Pathogenic	rs764139009	RCV000454246	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Macrothrombocytopenia	Likely pathogenic	rs2146345102, rs2016866550	RCV002254216 RCV002254230	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Macrothrombocytopenia and granulocyte inclusions with or without nephritis or sensorineural hearing loss	Pathogenic; Likely pathogenic	rs1603484060, rs2146345102, rs2146392811, rs2146325507, rs1397006934, rs2016767710, rs1364444432, rs2146392922, rs727503284, rs2146343691, rs878924546, rs1569534805, rs797044804, rs2517965997, rs1603483387, rs80338835, rs80338834, rs80338829, rs121913655, rs80338831, rs121913656, rs80338826, rs80338828, rs587776808, rs80338827, rs121913657, rs876661302, rs2146392848, rs2518014383, rs867593888, rs80338830, rs1321659356, rs1184544985, rs1603484047, rs1603484048	RCV001328951 RCV002226406 RCV002245333 RCV002245416 RCV002245419 RCV002245421 RCV002249107 RCV002261475 RCV002266358 RCV002280935 RCV002280938 RCV002280939 RCV002478429 RCV000192270 RCV003388257 RCV003484542 RCV000015116 RCV000015119 RCV000015121 RCV000015122 RCV000032223 RCV000015124 RCV000015129 RCV000032218 RCV000015131 RCV000015132 RCV000015134 RCV000015138 RCV000015139 RCV000015141 RCV000015142 RCV003991229 RCV003992042 RCV000032221 RCV000032224 RCV002470950 RCV002245640 RCV002222623 RCV002245639	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
May-Hegglin Disorder	Likely pathogenic	rs2017727647	RCV001174533	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MYH9-related disorder	Likely pathogenic; Pathogenic	rs797044804, rs2517943417, rs2517943425, rs2517958128, rs80338835, rs80338834, rs80338829, rs121913655, rs80338826, rs80338827, rs80338831, rs121913657, rs867593888, rs1603482650, rs1603482652, rs1603482653, rs1603483058, rs1184544985, rs1603483388, rs1603484047, rs1603484048, rs1603484060, rs1603484059	RCV000790360 RCV004527834 RCV004528556 RCV004529278 RCV000790363 RCV000790361 RCV000790357 RCV000790350 RCV000790354 RCV000851738 RCV000790358 RCV000790352 RCV000790359 RCV000852126 RCV000790348 RCV000790364 RCV000790362 RCV000790340 RCV000790355 RCV000790353 RCV000790351 RCV000790349 RCV000790337 RCV000851737 RCV000852253	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Rare genetic deafness	Pathogenic	rs727503284	RCV000151326	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombocytopenia	Pathogenic; Likely pathogenic	rs80338835, rs80338829, rs80338831	RCV001270545 RCV001270614 RCV001271110	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (55)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign; Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atypical hemolytic-uremic syndrome	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT ISOLATED SENSORINEURAL DEAFNESS TYPE DFNA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT NONSYNDROMIC HEARING LOSS	—	Disgenet	20301607, 24148127	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	28650484	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Capillary infantile hemangioma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	36428691	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, LOBULAR	—	CTD	28650484	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cataract 35	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT, CONGENITAL NUCLEAR, AUTOSOMAL RECESSIVE 1	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	37069358	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 17	—	Disgenet, HPO Disgenet, HPO	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT NONSYNDROMIC SENSORINEURAL 17	—	CTD	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT, 17	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	26305897	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL GLOMERULOSCLEROSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal segmental glomerulosclerosis	Benign; Likely benign; Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Conflicting classifications of pathogenicity	ClinVar Disgenet	—	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hearing impairment	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign	ClinVar Disgenet	—	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hepatocellular carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Homocystinuria due to methylene tetrahydrofolate reductase deficiency	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, RENAL	—	CTD	18794856	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE NEPHROPATHY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney disorder	Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	18794854, 18794856	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meniere disease	Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar Disgenet	—	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrotic syndrome	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar Disgenet	—	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nonsyndromic Hearing Loss, Dominant	Benign; Likely benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RENAL HYPERTENSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBASTIAN SYNDROME	—	Disgenet	15555549,1912569,11776386,11159552,12237319,12533692,9390828,10739770,12792306,16162639,5011389,17146397,11093280,11752022,12649151,15496418,15064761,18059020,8280620,11590545,10603121,1860190,11023810,16630581,19450438,11935325,10973260,15667538	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS OF BILATERAL EARS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe X-linked myotubular myopathy	Conflicting classifications of pathogenicity	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Type 1 diabetes mellitus 17	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	37544299, 40050615	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitelliform macular dystrophy 1	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (226)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	16276527		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	27437869		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	25826333		★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	CTD_human_DG	10973259		★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	12819239		★☆☆☆☆ Found in Text Mining only
Alport Syndrome, Autosomal Dominant	Alport Syndrome	CTD_human_DG	10973259		★☆☆☆☆ Found in Text Mining only
Alport Syndrome, Autosomal Recessive	Alport Syndrome	CTD_human_DG	10973259		★☆☆☆☆ Found in Text Mining only
Alport Syndrome, X-Linked	Alport Syndrome, X-Linked	CTD_human_DG	10973259		★☆☆☆☆ Found in Text Mining only
Alport Syndrome, X-Linked	Alport Syndrome, X-Linked	BEFREE	23144074		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30872628		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	30872628	Associate	★☆☆☆☆ Found in Text Mining only
Andersen Syndrome	Andersen Syndrome	BEFREE	23144074		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	21910715	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21910715, 26147622		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	20124285	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30583228		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30583228		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	26446054		★☆☆☆☆ Found in Text Mining only
ARTERIAL TORTUOSITY SYNDROME	Arterial Tortuosity Syndrome	BEFREE	23144074		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21429915		★☆☆☆☆ Found in Text Mining only
Asthenozoospermia	Asthenozoospermia	Pubtator	38099337	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21429915		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23122533		★☆☆☆☆ Found in Text Mining only
Autosomal dominant macrothrombocytopenia	Macrothrombocytopenia	BEFREE	11159552, 11776386		★☆☆☆☆ Found in Text Mining only
Autosomal dominant non-syndromic sensorineural deafness type DFNA	Non-Syndromic Sensorineural Deafness	Orphanet			★☆☆☆☆ Found in Text Mining only
Bernard Soulier Syndrome	Bernard-soulier syndrome	Pubtator	20635188, 27291889	Associate	★☆☆☆☆ Found in Text Mining only
Bernard-Soulier Syndrome	Bernard Soulier Syndrome	BEFREE	14635206, 18278172, 20635188		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	35821008	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy	Bladder exstrophy	Pubtator	34355505	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	17655694		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	33962937	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet-type bleeding disorder	BEFREE	11935325, 16044442, 16098078, 19408192, 19645626, 26247237		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	16044442, 16098078, 23382103, 26247237, 33649034, 35064207, 36404341, 40685626	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18796164, 21782877, 22623409, 30258071		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	28650484		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22722193, 29953877, 30258071, 34450253, 37200287	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Capillary malformation (disorder)	Capillary malformation	BEFREE	23122533		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29903892, 34743203	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35414777, 36374212, 37069693	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23713811		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35650603	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31423165		★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	26247237	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid Artery Thrombosis	BEFREE	28539835		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	10973259, 16162639, 16596254, 17975807, 19645626		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	17975807, 19557653, 20807613, 24186861, 24890873, 26247237, 29782633, 29996171, 31977897, 38042490	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	GENOMICS_ENGLAND_DG	22627578		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	25730040		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	18794854, 19177153, 19567477, 19838113, 20124285, 20144966, 20492585, 20532800, 20635188, 21074826, 21245129, 21698141, 21849968, 21910715, 21968013, 22541678, 23470845, 24186861, 24551085, 26343748		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19726116, 19921264, 20588287, 21071974, 21216884, 21402784, 21429915, 21537348, 22956460, 23285077, 23470845, 23516419, 26152646, 27924804, 29665793, 29679756, 30340464		★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	BEFREE	23940247		★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	19320731, 19891592		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30854093		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32413870, 36345155	Associate	★☆☆☆☆ Found in Text Mining only
Congenital cataract	Congenital Cataract	BEFREE	29200148		★☆☆☆☆ Found in Text Mining only
Congenital thrombocytopenia	Congenital thrombocytopenia	BEFREE	28594466, 29286575		★☆☆☆☆ Found in Text Mining only
Congenital thrombocytopenia	Congenital thrombocytopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27634189		★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	39202364	Associate	★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	11590545, 17975807, 19557653, 24186861, 24890873, 36282680, 38042490	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DEAFNESS, AUTOSOMAL DOMINANT 17	Deafness	CTD_human_DG	10973259, 11590545, 12621333		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 17	Deafness	BEFREE	11023810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 17	Deafness	UNIPROT_DG	11023810		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 17	Deafness	CLINVAR_DG	11752022, 16969870, 23409987, 24186861, 26226608		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 17	Deafness	GENOMICS_ENGLAND_DG	25077172, 9390828		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deafness, autosomal dominant nonsyndromic sensorineural 17	Deafness, Nonsyndromic Sensorineural	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep Vein Thrombosis	Thrombosis	BEFREE	23037321		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18923054, 23285077		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18923054, 23285077		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20144966, 21074826, 21454968, 22956460, 23285077, 36837510	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19567477, 21698141, 26634513	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19567477, 21074826, 21849968, 24551085, 25730040		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	21968013, 22956460, 24658608, 29862302, 34946941	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	20347641, 21074826, 21429915, 21968013, 22956460, 24011553, 29862302, 31118506		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	GWASDB_DG	21150874		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	GWASCAT_DG	26305897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	16098078, 19557653		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	29903892	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	16276527		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31423165		★☆☆☆☆ Found in Text Mining only
Epstein syndrome (disorder)	Epstein syndrome	BEFREE	11590545, 11935325, 17241369, 17655694, 19839854, 29532554		★☆☆☆☆ Found in Text Mining only
Epstein syndrome (disorder)	Epstein syndrome	CLINGEN_DG	15339844, 16162639, 16630581, 16862555, 17146397, 21542825, 21908426, 23976996, 24890873, 25505834, 9390828		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25605255, 32788880	Associate	★☆☆☆☆ Found in Text Mining only
Familial hematuria	Hematuria	BEFREE	23516419		★☆☆☆☆ Found in Text Mining only
Fechtner syndrome (disorder)	Fechtner syndrome	BEFREE	11935325, 12500226, 12649151, 17655694, 20200500, 22886561, 23144074		★☆☆☆☆ Found in Text Mining only
Fechtner syndrome (disorder)	Fechtner syndrome	CLINGEN_DG	15339844, 16162639, 16630581, 16862555, 17146397, 21542825, 21908426, 23976996, 24890873, 25505834, 9390828		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	12819239, 18794856, 19153477, 19177153, 19567477, 19726116, 19764949, 19838113, 20051853, 20124285, 20200500, 20347641, 20668430, 21074826, 21402784, 21910715, 21968013, 21997397, 22614628, 22791322		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	LHGDN	18794856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	18794856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Focal Segmental Glomerulosclerosis, Not Otherwise Specified	Focal segmental glomerulosclerosis	BEFREE	20124285, 21997397		★☆☆☆☆ Found in Text Mining only
Frasier Syndrome	Fraser syndrome	Pubtator	16098078	Associate	★☆☆☆☆ Found in Text Mining only
Giant Platelet Syndrome with Thrombocytopenia	Giant Platelet Syndrome With Thrombocytopenia	CLINGEN_DG	15339844, 16162639, 16630581, 16862555, 17146397, 21542825, 21908426, 23976996, 24890873, 25505834, 9390828		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34887392	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	16162639, 16596254, 20601875		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Glomerulonephritis	Glomerulonephritis	Pubtator	19177153, 24890873	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	20005488, 20051853, 20688934, 21074826, 21402784, 22956460		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	18794856, 19177153, 19764949, 20124285, 20200500, 20523037, 20668430, 21910715, 21968013, 22791322, 22956460	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	33882342	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	13680298		★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	15477207		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28160562		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	28160562, 36139430	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	20200500	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	16098078, 24890873, 26247237, 30872814, 31562665, 36282680	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	20807613, 23123319, 24890873, 29996171, 31977897	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss, High-Frequency	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37092838	Associate	★☆☆☆☆ Found in Text Mining only
HEMANGIOMA, CAPILLARY INFANTILE	Hemangioma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	36282680	Associate	★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	20200500	Associate	★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	23516419	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	26247237, 30916803, 35064207, 36404341, 38042490	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic disease	Pubtator	31562665	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic hereditary nephritis	Alport syndrome	CTD_human_DG	10973259		★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	27126235		★☆☆☆☆ Found in Text Mining only
Hereditary nephritis	Hereditary Nephritis	CTD_human_DG	10973259		★☆☆☆☆ Found in Text Mining only
Hyalinosis, Segmental Glomerular	Glomerular Hyalinosis	CTD_human_DG	18794856		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19153477, 19177153, 20124285, 20635188, 20807613, 22956460, 27924804	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18923054, 19153477, 19177153, 19567477, 19838113, 20051853, 20124285, 22614628, 22832513, 22956460, 27924804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	21691125		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	21245129		★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	23759689		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	25703294		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	12800156		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	12800156		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	11752022, 11935325, 12500226, 18923054, 19153477, 19177153, 19567477, 19764949, 19838113, 19921264, 20005488, 20051853, 20124285, 20200500, 20299374, 20347641, 20492585, 20634883, 20635188, 20688934, 20807613, 20979964, 21074826, 21402784, 21429915, 21698141, 21910715, 21968013, 21997397, 22189356, 22614628, 22832513, 22956460, 23123319, 23285077, 23397215, 23438974, 23470845, 23516419, 26226608, 26343748, 28478097, 29532554, 30471777		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	16098078, 19567477, 19764949, 19921264, 20124285, 20200500, 20309925, 20347640, 20588287, 20634883, 20807613, 21454968, 21910715, 21968013, 22956460, 23285077, 23516419, 24186861, 24551085, 26343748, 26776194, 29782633, 29996171, 31243205, 31977897, 32873246, 35125114, 35404999, 36282680, 38042490	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	LHGDN	18794854, 18794856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	15177565, 19567477, 19838113, 21071974, 21698141, 21968013, 26247237, 28594466		★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	GENOMICS_ENGLAND_DG	22627578		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	18794854, 18794856, 19177153, 19567477, 20124285, 20144966, 20532800, 20635188, 20668430, 20807613, 21074826, 21698141, 21910715, 21968013, 23285077, 24186861, 24658608, 26776194, 29782633, 30212930, 32011449	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	18794854, 18794856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	18794854, 19177153, 19567477, 19838113, 20124285, 20144966, 20492585, 20532800, 20635188, 21074826, 21245129, 21698141, 21849968, 21910715, 21968013, 22541678, 23470845, 24186861, 24551085, 26343748		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22898599, 27437869, 32422910, 36175877	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16276527, 27437869		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	22189356, 24658608		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	22189356, 24658608	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	32788880	Associate	★☆☆☆☆ Found in Text Mining only
Macrothrombocytopenia	Macrothrombocytopenia	BEFREE	11590545, 11752022, 11935325, 11943476, 12621333, 15177565, 15342975, 15555549, 16162639, 16630581, 17655694, 17975807, 18192507, 19285578, 19408192, 20200500, 20588287, 20601875, 23037321, 23123319, 24165359, 24890873, 25395423, 25703294, 29286575, 29996171		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MACROTHROMBOCYTOPENIA AND PROGRESSIVE SENSORINEURAL DEAFNESS	MACROTHROMBOCYTOPENIA AND PROGRESSIVE SENSORINEURAL DEAFNESS	CTD_human_DG	12621333		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	30068598		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28160562		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18796164, 21782877, 22623409, 30258071		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	28650484		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23713811		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31358530		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28184940, 28900514, 30613301, 31726371		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	28049826		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25826333, 29679756, 30739906		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	28650484		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	28650484		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	28650484		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26554828	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21346779	Associate	★☆☆☆☆ Found in Text Mining only
MYH9-related disease	MYH9-Related Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	26247237	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	20532800	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31594754, 31754475		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	37875476	Associate	★☆☆☆☆ Found in Text Mining only
Neonatal Alloimmune Thrombocytopenia	Alloimmune Thrombocytopenia	BEFREE	29286575		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24436421, 30739906, 31538390, 31754475		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	10973259, 20200500, 28714588		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	LHGDN	18059020		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	Pubtator	19153477, 19177153	Associate	★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	BEFREE	19153477		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	19764949, 29782633	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	19764949		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Neuroblastoma	Neuroblastoma	Pubtator	37947594	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	35404999	Associate	★☆☆☆☆ Found in Text Mining only
Nodular fasciitis	Nodular Fasciitis	ORPHANET_DG	21826056		★☆☆☆☆ Found in Text Mining only
Nodular fasciitis	Nodular Fasciitis	Orphanet			★☆☆☆☆ Found in Text Mining only
Nodular fasciitis	Nodular Fasciitis	BEFREE	30611632, 31538390		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25826333		★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	19645626		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36837510	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Orofacial Cleft 1	Orofacial cleft	Pubtator	18716610, 27527345	Associate	★☆☆☆☆ Found in Text Mining only
OROFACIAL CLEFT 1	Orofacial Cleft	BEFREE	19891592, 27527345		★☆☆☆☆ Found in Text Mining only
Other primary thrombocytopenia	Thrombocytopenia	CLINGEN_DG	15339844, 16162639, 16630581, 16862555, 17146397, 21542825, 21908426, 23976996, 24890873, 25505834, 9390828		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36929633	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31358530		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	28594466		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28049826		★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	23037321		★☆☆☆☆ Found in Text Mining only
Presenile cataract	Presenile Cataract	BEFREE	22627578		★☆☆☆☆ Found in Text Mining only
Presenile cataract	Presenile Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35589707, 36202978	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	20200500, 21910715, 31243205, 32873246, 35404999	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27634189		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	20807613, 21402784, 31118506		★☆☆☆☆ Found in Text Mining only
Renal hypertension	Renal Hypertension	CTD_human_DG	18794856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	29104083	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	18571626, 20188514		★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	10973259, 10973260, 11159552, 11590545, 11776386, 11935325, 11943476, 12161364, 12217806, 12649151, 15177565, 15477207, 15869600, 16596254, 16630581, 16806139, 16818291, 17241369, 17655694, 18059020, 18192507, 19408192, 19450438, 19572073, 19726116, 19839854, 20002731, 20174760, 20200500, 20603234, 20844233, 21210153, 21833445, 22477015, 22627578, 22886561, 23007341, 23123319, 23144074, 23207509, 23759689, 23940247, 24186861, 24890873, 26226608, 26446054, 29090586, 29532554, 30807393, 30916803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	CTD_human_DG	10973259, 11590545, 12621333		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	CLINGEN_DG	15339844, 16162639, 16630581, 16862555, 17146397, 21542825, 21908426, 23976996, 24890873, 25505834, 9390828		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	CLINVAR_DG	31064749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	39202364	Associate	★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	10973259, 16596254, 17146397, 19645626, 20807613, 23123319, 24890873, 26226608, 29996171		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	GENOMICS_ENGLAND_DG	22627578		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24436421		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31735331		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35125114	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28184940, 28900514, 30613301, 31726371		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28900514, 34895039	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	15869600, 16098078, 19557653, 20844233, 24890873, 29090586, 29996171, 31562665, 31977897, 33649034, 35125114, 36404341, 39202364	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
THROMBOCYTOPENIA 1 (disorder)	Thrombocytopenia	BEFREE	15477207		★☆☆☆☆ Found in Text Mining only
THROMBOCYTOPENIA 2 (disorder)	Thrombocytopenia	BEFREE	19572073, 20174760, 29996171		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	26247237	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28049826	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28049826		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	28049826		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28049826, 38165228	Associate	★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	26247237, 31977897	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	31427716		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34450253	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	39293140	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MYH14 5 shared diseasesIsolated sensorineural deafness, Nonsyndromic hearing loss, Deafness, Hereditary hearing loss, Meniere disease 8 shared pathwaysVirion - Lassa virus and SFTS virus, Vascular smooth muscle contraction, Tight junction, Regulation of actin cytoskeleton, Motor proteins, Cytoskeleton in muscle cells, Pathogenic Escherichia coli infection, RHO GTPases activate PAKs 9 shared evidence sourcesDisgenet (Isolated sensorineural deafness), Disgenet (Nonsyndromic hearing loss), ClinVar (Nonsyndromic hearing loss), GenCC (Nonsyndromic hearing loss), Disgenet (Deafness), HPO (Deafness), Disgenet (Hearing loss), ClinVar (Hereditary hearing loss), Disgenet (Meniere disease) Related via 8 shared pathways including Virion - Lassa virus and SFTS virus, Vascular smooth muscle contraction — evidence mostly Disgenet. MYO6 6 shared diseasesIsolated sensorineural deafness, Nonsyndromic hearing loss, Deafness, Autosomal dominant sensorineural deafness, Hereditary hearing loss, Meniere disease 2 shared pathwaysMotor proteins, Pathogenic Escherichia coli infection 9 shared evidence sourcesDisgenet (Isolated sensorineural deafness), Disgenet (Nonsyndromic hearing loss), ClinVar (Nonsyndromic hearing loss), GenCC (Nonsyndromic hearing loss), Disgenet (Deafness), HPO (Deafness), Disgenet (Hearing loss), ClinVar (Hereditary hearing loss), Disgenet (Meniere disease) Related via 6 shared diseases including Isolated sensorineural deafness, Nonsyndromic hearing loss — evidence mostly Disgenet. TRIOBP 5 shared diseasesIsolated sensorineural deafness, Nonsyndromic hearing loss, Deafness, Hereditary hearing loss, Meniere disease 9 shared evidence sourcesDisgenet (Isolated sensorineural deafness), Disgenet (Nonsyndromic hearing loss), ClinVar (Nonsyndromic hearing loss), GenCC (Nonsyndromic hearing loss), Disgenet (Deafness), HPO (Deafness), Disgenet (Hearing loss), ClinVar (Hereditary hearing loss), Disgenet (Meniere disease) Related via 5 shared diseases including Isolated sensorineural deafness, Nonsyndromic hearing loss — evidence mostly Disgenet. RDX 5 shared diseasesIsolated sensorineural deafness, Nonsyndromic hearing loss, Deafness, Diabetic neuropathy, Hereditary hearing loss 2 shared pathwaysTight junction, Regulation of actin cytoskeleton 8 shared evidence sourcesDisgenet (Isolated sensorineural deafness), Disgenet (Nonsyndromic hearing loss), ClinVar (Nonsyndromic hearing loss), Disgenet (Deafness), HPO (Deafness), GWAS catalog (Diabetic neuropathy), Disgenet (Hearing loss), ClinVar (Hereditary hearing loss) Related via 5 shared diseases including Isolated sensorineural deafness, Nonsyndromic hearing loss — evidence mostly Disgenet. KCNQ4 4 shared diseasesIsolated sensorineural deafness, Nonsyndromic hearing loss, Deafness, Hereditary hearing loss 8 shared evidence sourcesDisgenet (Isolated sensorineural deafness), Disgenet (Nonsyndromic hearing loss), ClinVar (Nonsyndromic hearing loss), GenCC (Nonsyndromic hearing loss), Disgenet (Deafness), HPO (Deafness), Disgenet (Hearing loss), ClinVar (Hereditary hearing loss) Related via 4 shared diseases including Isolated sensorineural deafness, Nonsyndromic hearing loss — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MYH14	5	["Isolated sensorineural deafness","Nonsyndromic hearing loss","Deafness","Hereditary hearing loss","Meniere disease"]	8	["Virion - Lassa virus and SFTS virus","Vascular smooth muscle contraction","Tight junction","Regulation of actin cytoskeleton","Motor proteins","Cytoskeleton in muscle cells","Pathogenic Escherichia coli infection","RHO GTPases activate PAKs"]	9	["Disgenet (Isolated sensorineural deafness)","Disgenet (Nonsyndromic hearing loss)","ClinVar (Nonsyndromic hearing loss)","GenCC (Nonsyndromic hearing loss)","Disgenet (Deafness)","HPO (Deafness)","Disgenet (Hearing loss)","ClinVar (Hereditary hearing loss)","Disgenet (Meniere disease)"]
MYO6	6	["Isolated sensorineural deafness","Nonsyndromic hearing loss","Deafness","Autosomal dominant sensorineural deafness","Hereditary hearing loss","Meniere disease"]	2	["Motor proteins","Pathogenic Escherichia coli infection"]	9	["Disgenet (Isolated sensorineural deafness)","Disgenet (Nonsyndromic hearing loss)","ClinVar (Nonsyndromic hearing loss)","GenCC (Nonsyndromic hearing loss)","Disgenet (Deafness)","HPO (Deafness)","Disgenet (Hearing loss)","ClinVar (Hereditary hearing loss)","Disgenet (Meniere disease)"]
TRIOBP	5	["Isolated sensorineural deafness","Nonsyndromic hearing loss","Deafness","Hereditary hearing loss","Meniere disease"]	0	[]	9	["Disgenet (Isolated sensorineural deafness)","Disgenet (Nonsyndromic hearing loss)","ClinVar (Nonsyndromic hearing loss)","GenCC (Nonsyndromic hearing loss)","Disgenet (Deafness)","HPO (Deafness)","Disgenet (Hearing loss)","ClinVar (Hereditary hearing loss)","Disgenet (Meniere disease)"]
RDX	5	["Isolated sensorineural deafness","Nonsyndromic hearing loss","Deafness","Diabetic neuropathy","Hereditary hearing loss"]	2	["Tight junction","Regulation of actin cytoskeleton"]	8	["Disgenet (Isolated sensorineural deafness)","Disgenet (Nonsyndromic hearing loss)","ClinVar (Nonsyndromic hearing loss)","Disgenet (Deafness)","HPO (Deafness)","GWAS catalog (Diabetic neuropathy)","Disgenet (Hearing loss)","ClinVar (Hereditary hearing loss)"]
KCNQ4	4	["Isolated sensorineural deafness","Nonsyndromic hearing loss","Deafness","Hereditary hearing loss"]	0	[]	8	["Disgenet (Isolated sensorineural deafness)","Disgenet (Nonsyndromic hearing loss)","ClinVar (Nonsyndromic hearing loss)","GenCC (Nonsyndromic hearing loss)","Disgenet (Deafness)","HPO (Deafness)","Disgenet (Hearing loss)","ClinVar (Hereditary hearing loss)"]

Diseases Linked via Similar Genes

nonsyndromic genetic hearing loss Linked via 4 of 5 related genesMYH14, MYO6, RDX, KCNQ4 Atrial fibrillation Linked via 2 of 5 related genesMYO6, TRIOBP Osteoarthritis Linked via 2 of 5 related genesMYO6, TRIOBP Diabetes mellitus type 2 Linked via 2 of 5 related genesMYO6, RDX Dilated cardiomyopathy Linked via 1 of 5 related genesMYH14

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
nonsyndromic genetic hearing loss	4	["MYH14","MYO6","RDX","KCNQ4"]
Atrial fibrillation	2	["MYO6","TRIOBP"]
Osteoarthritis	2	["MYO6","TRIOBP"]
Diabetes mellitus type 2	2	["MYO6","RDX"]
Dilated cardiomyopathy	1	["MYH14"]