MYG1 (MYG1 exonuclease)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 60314
• Gene name: MYG1 exonuclease
• Gene symbol: MYG1
• Synonyms (NCBI Gene): C12orf10, Gamm1, MST024, MSTP024, MYG
• Chromosome: 12
• Chromosome location: 12q13.13

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000175	Function	3'-5'-RNA exonuclease activity	IDA	31081026
GO:0000959	Process	Mitochondrial RNA metabolic process	IMP	31081026
GO:0004518	Function	Nuclease activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19014353, 20377893
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	31081026
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005730	Component	Nucleolus	IDA	31081026
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	19014353, 20377893
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	31081026
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0006364	Process	RRNA processing	IMP	31081026
GO:0006397	Process	MRNA processing	IMP	31081026
GO:0016787	Function	Hydrolase activity	IEA
GO:0035641	Process	Locomotory exploration behavior	IEA

Other IDs

• MIM: 611366
• HGNC: 17590
• e!Ensembl: ENSG00000139637

Protein

• UniProt ID: Q9HB07
• Protein name: MYG1 exonuclease (EC 3.1.-.-)
• Protein function: 3'-5' RNA exonuclease which cleaves in situ on specific transcripts in both nucleus and mitochondrion. Involved in regulating spatially segregated organellar RNA processing, acts as a coordinator of nucleo-mitochondrial crosstalk (PubMed:3108102
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03690	UPF0160	46 → 366	Uncharacterised protein family (UPF0160)	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed, with highest levels in testis. {ECO:0000269|PubMed:19014353}.
• Sequence:

  MGHRFLRGLLTLLLPPPPLYTRHRMLGPESVPPPKRSRSKLMAPPRIGTHNGTFHCDEAL
  ACALLRLLPEYRDAEIVRTRDPEKLASCDIVVDVGGEYDPRRHRYDHHQRSFTETMSSLS
  PGKPWQTKLSSAGLIYLHFGHKLLAQLLGTSEEDSMVGTLYDKMYENFVEEVDAVDNGIS
  QWAEGEPRYALTTTLSARVARLNPTWNHPDQDTEAGFKRAMDLVQEEFLQRLDFYQHSWL
  PARALVEEALAQRFQVDPSGEIVELAKGACPWKEHLYHLESGLSPPVAIFFVIYTDQAGQ
  WRIQCVPKEPHSFQSRLPLPEPWRGLRDEALDQVSGIPGCIFVHASGFTGGHHTREGALS
  MARATLAQRSYLPQIS

• Sequence length: 376

Related Genes

No strongly related genes found yet for MYG1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MYG1.