Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	4615
Gene name	MYD88 innate immune signal transduction adaptor
Gene symbol	MYD88
Synonyms (NCBI Gene)	IMD68MYD88DWM1
Chromosome	3
Chromosome location	3p22.2
Summary	This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways reg

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs137853064	C>A,G,T	Pathogenic	Non coding transcript variant, missense variant, intron variant, coding sequence variant
rs387907272	T>C	Likely-pathogenic, uncertain-significance, pathogenic	Stop lost, missense variant, coding sequence variant, terminator codon variant, non coding transcript variant

297

Show/Hide all (297)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007368	hsa-miR-203a-3p	Luciferase reporter assayqRT-PCRWestern blot	23522925
MIRT007368	hsa-miR-203a-3p	Luciferase reporter assayqRT-PCRWestern blot	23522925
MIRT020533	hsa-miR-155-5p	Western blot	21030878
MIRT054356	hsa-miR-21-5p	ChipELISAFlow cytometryLuciferase reporter assayQRTPCRWestern blot	23633945
MIRT438020	hsa-miR-149-5p	ELISAqRT-PCRWestern blot	24375488
MIRT438020	hsa-miR-149-5p	ELISAqRT-PCRWestern blot	24375488
MIRT438020	hsa-miR-149-5p	ELISAqRT-PCRWestern blot	24375488
MIRT438020	hsa-miR-149-5p	ELISAqRT-PCRWestern blot	24375488
MIRT527507	hsa-miR-5690	PAR-CLIP	22012620
MIRT237424	hsa-miR-6817-3p	PAR-CLIP	22012620
MIRT527506	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT527505	hsa-miR-155-3p	PAR-CLIP	22012620
MIRT527504	hsa-miR-3685	PAR-CLIP	22012620
MIRT527503	hsa-miR-384	PAR-CLIP	22012620
MIRT438020	hsa-miR-149-5p	Luciferase reporter assayWestern blottingqRT-PCR	31855318
MIRT735107	hsa-miR-124-3p	Western blottingImmunohistochemistry (IHC)	32850781
MIRT735382	hsa-miR-146a-5p	qRT-PCR	31739406
MIRT736264	hsa-miR-30a-3p	Luciferase reporter assayWestern blottingImmunofluorescence	31958204
MIRT736431	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT527505	hsa-miR-155-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)ImmunofluorescenceqRT-PCR	32031337
MIRT527507	hsa-miR-5690	PAR-CLIP	22012620
MIRT237424	hsa-miR-6817-3p	PAR-CLIP	22012620
MIRT527506	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT527505	hsa-miR-155-3p	PAR-CLIP	22012620
MIRT527504	hsa-miR-3685	PAR-CLIP	22012620
MIRT527503	hsa-miR-384	PAR-CLIP	22012620
MIRT755407	hsa-miR-505-5p	Luciferase reporter assayWestern blottingqRT-PCR	35959879
MIRT735382	hsa-miR-146a-5p	Western blotting	36210830
MIRT1167937	hsa-miR-1224-3p	CLIP-seq
MIRT1167938	hsa-miR-1260	CLIP-seq
MIRT1167939	hsa-miR-1260b	CLIP-seq
MIRT1167940	hsa-miR-1280	CLIP-seq
MIRT1167941	hsa-miR-1286	CLIP-seq
MIRT1167942	hsa-miR-155	CLIP-seq
MIRT1167943	hsa-miR-188-3p	CLIP-seq
MIRT1167944	hsa-miR-198	CLIP-seq
MIRT1167945	hsa-miR-203	CLIP-seq
MIRT1167946	hsa-miR-2278	CLIP-seq
MIRT1167947	hsa-miR-2355-5p	CLIP-seq
MIRT1167948	hsa-miR-2964a-5p	CLIP-seq
MIRT1167949	hsa-miR-3119	CLIP-seq
MIRT1167950	hsa-miR-3156-3p	CLIP-seq
MIRT1167951	hsa-miR-3199	CLIP-seq
MIRT1167952	hsa-miR-3611	CLIP-seq
MIRT1167953	hsa-miR-3646	CLIP-seq
MIRT1167954	hsa-miR-3660	CLIP-seq
MIRT1167955	hsa-miR-3925-3p	CLIP-seq
MIRT1167956	hsa-miR-4252	CLIP-seq
MIRT1167957	hsa-miR-4267	CLIP-seq
MIRT1167958	hsa-miR-4276	CLIP-seq
MIRT1167959	hsa-miR-4330	CLIP-seq
MIRT1167960	hsa-miR-4436a	CLIP-seq
MIRT1167961	hsa-miR-4461	CLIP-seq
MIRT1167962	hsa-miR-4469	CLIP-seq
MIRT1167963	hsa-miR-4470	CLIP-seq
MIRT1167964	hsa-miR-4476	CLIP-seq
MIRT1167965	hsa-miR-4526	CLIP-seq
MIRT1167966	hsa-miR-4642	CLIP-seq
MIRT1167967	hsa-miR-4666-5p	CLIP-seq
MIRT1167968	hsa-miR-4670-3p	CLIP-seq
MIRT1167969	hsa-miR-4691-5p	CLIP-seq
MIRT1167970	hsa-miR-4693-3p	CLIP-seq
MIRT1167971	hsa-miR-4696	CLIP-seq
MIRT1167972	hsa-miR-4715-5p	CLIP-seq
MIRT1167973	hsa-miR-4722-5p	CLIP-seq
MIRT1167974	hsa-miR-4732-5p	CLIP-seq
MIRT1167975	hsa-miR-4793-5p	CLIP-seq
MIRT1167976	hsa-miR-552	CLIP-seq
MIRT1167977	hsa-miR-562	CLIP-seq
MIRT1167978	hsa-miR-654-3p	CLIP-seq
MIRT1167979	hsa-miR-665	CLIP-seq
MIRT1167980	hsa-miR-766	CLIP-seq
MIRT1167981	hsa-miR-944	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT1167957	hsa-miR-4267	CLIP-seq
MIRT1167981	hsa-miR-944	CLIP-seq
MIRT2277301	hsa-miR-1236	CLIP-seq
MIRT1167941	hsa-miR-1286	CLIP-seq
MIRT2277302	hsa-miR-1343	CLIP-seq
MIRT1167944	hsa-miR-198	CLIP-seq
MIRT1167945	hsa-miR-203	CLIP-seq
MIRT1167948	hsa-miR-2964a-5p	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT2277303	hsa-miR-3147	CLIP-seq
MIRT2277304	hsa-miR-3158-5p	CLIP-seq
MIRT2277305	hsa-miR-3166	CLIP-seq
MIRT2277306	hsa-miR-3183	CLIP-seq
MIRT2277307	hsa-miR-320e	CLIP-seq
MIRT1167955	hsa-miR-3925-3p	CLIP-seq
MIRT2277308	hsa-miR-3977	CLIP-seq
MIRT1167957	hsa-miR-4267	CLIP-seq
MIRT1167960	hsa-miR-4436a	CLIP-seq
MIRT1167961	hsa-miR-4461	CLIP-seq
MIRT2277309	hsa-miR-4503	CLIP-seq
MIRT2277310	hsa-miR-4660	CLIP-seq
MIRT1167973	hsa-miR-4722-5p	CLIP-seq
MIRT2277311	hsa-miR-4723-3p	CLIP-seq
MIRT2277312	hsa-miR-4771	CLIP-seq
MIRT2277313	hsa-miR-493	CLIP-seq
MIRT1167977	hsa-miR-562	CLIP-seq
MIRT2277314	hsa-miR-646	CLIP-seq
MIRT1167979	hsa-miR-665	CLIP-seq
MIRT2277315	hsa-miR-668	CLIP-seq
MIRT1167980	hsa-miR-766	CLIP-seq
MIRT2576146	hsa-miR-1184	CLIP-seq
MIRT2576147	hsa-miR-1205	CLIP-seq
MIRT2277301	hsa-miR-1236	CLIP-seq
MIRT2576148	hsa-miR-1245b-3p	CLIP-seq
MIRT2576149	hsa-miR-140-3p	CLIP-seq
MIRT2576150	hsa-miR-147	CLIP-seq
MIRT2576151	hsa-miR-183	CLIP-seq
MIRT2576152	hsa-miR-185	CLIP-seq
MIRT2576153	hsa-miR-188-5p	CLIP-seq
MIRT2576154	hsa-miR-2110	CLIP-seq
MIRT1167947	hsa-miR-2355-5p	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT2576155	hsa-miR-302f	CLIP-seq
MIRT2576156	hsa-miR-3144-5p	CLIP-seq
MIRT2277303	hsa-miR-3147	CLIP-seq
MIRT2576157	hsa-miR-3150a-3p	CLIP-seq
MIRT2277304	hsa-miR-3158-5p	CLIP-seq
MIRT2576158	hsa-miR-3160-3p	CLIP-seq
MIRT2277306	hsa-miR-3183	CLIP-seq
MIRT2576159	hsa-miR-3189-3p	CLIP-seq
MIRT2576160	hsa-miR-3191	CLIP-seq
MIRT2576161	hsa-miR-3192	CLIP-seq
MIRT2576162	hsa-miR-3194-3p	CLIP-seq
MIRT2277307	hsa-miR-320e	CLIP-seq
MIRT2576163	hsa-miR-326	CLIP-seq
MIRT2576164	hsa-miR-330-5p	CLIP-seq
MIRT2576165	hsa-miR-346	CLIP-seq
MIRT1167953	hsa-miR-3646	CLIP-seq
MIRT1167954	hsa-miR-3660	CLIP-seq
MIRT2576166	hsa-miR-3667-5p	CLIP-seq
MIRT2576167	hsa-miR-3689a-3p	CLIP-seq
MIRT2576168	hsa-miR-3689c	CLIP-seq
MIRT2576169	hsa-miR-3689d	CLIP-seq
MIRT2576170	hsa-miR-3925-5p	CLIP-seq
MIRT2576171	hsa-miR-3937	CLIP-seq
MIRT2576172	hsa-miR-4288	CLIP-seq
MIRT2576173	hsa-miR-4289	CLIP-seq
MIRT2576174	hsa-miR-4293	CLIP-seq
MIRT2576175	hsa-miR-4306	CLIP-seq
MIRT2576176	hsa-miR-4314	CLIP-seq
MIRT2576177	hsa-miR-4419a	CLIP-seq
MIRT2576178	hsa-miR-4428	CLIP-seq
MIRT2576179	hsa-miR-4496	CLIP-seq
MIRT2277309	hsa-miR-4503	CLIP-seq
MIRT2576180	hsa-miR-4510	CLIP-seq
MIRT1167965	hsa-miR-4526	CLIP-seq
MIRT2576181	hsa-miR-4533	CLIP-seq
MIRT2576182	hsa-miR-4633-3p	CLIP-seq
MIRT2576183	hsa-miR-4644	CLIP-seq
MIRT2576184	hsa-miR-4646-5p	CLIP-seq
MIRT2576185	hsa-miR-4652-5p	CLIP-seq
MIRT2277310	hsa-miR-4660	CLIP-seq
MIRT2576186	hsa-miR-4661-3p	CLIP-seq
MIRT2576187	hsa-miR-4690-3p	CLIP-seq
MIRT2576188	hsa-miR-4711-3p	CLIP-seq
MIRT2576189	hsa-miR-4712-3p	CLIP-seq
MIRT2576190	hsa-miR-4713-5p	CLIP-seq
MIRT2277311	hsa-miR-4723-3p	CLIP-seq
MIRT2576191	hsa-miR-4728-5p	CLIP-seq
MIRT2576192	hsa-miR-4747-5p	CLIP-seq
MIRT2576193	hsa-miR-4755-3p	CLIP-seq
MIRT2576194	hsa-miR-4761-5p	CLIP-seq
MIRT2576195	hsa-miR-4773	CLIP-seq
MIRT1167975	hsa-miR-4793-5p	CLIP-seq
MIRT2576196	hsa-miR-4800-5p	CLIP-seq
MIRT2277313	hsa-miR-493	CLIP-seq
MIRT2576197	hsa-miR-544b	CLIP-seq
MIRT2576198	hsa-miR-548a-5p	CLIP-seq
MIRT2576199	hsa-miR-548ab	CLIP-seq
MIRT2576200	hsa-miR-548ak	CLIP-seq
MIRT2576201	hsa-miR-548b-5p	CLIP-seq
MIRT2576202	hsa-miR-548c-5p	CLIP-seq
MIRT2576203	hsa-miR-548d-5p	CLIP-seq
MIRT2576204	hsa-miR-548h	CLIP-seq
MIRT2576205	hsa-miR-548i	CLIP-seq
MIRT2576206	hsa-miR-548j	CLIP-seq
MIRT2576207	hsa-miR-548k	CLIP-seq
MIRT2576208	hsa-miR-548l	CLIP-seq
MIRT2576209	hsa-miR-548w	CLIP-seq
MIRT2576210	hsa-miR-548y	CLIP-seq
MIRT1167976	hsa-miR-552	CLIP-seq
MIRT2576211	hsa-miR-559	CLIP-seq
MIRT2576212	hsa-miR-591	CLIP-seq
MIRT2576213	hsa-miR-615-5p	CLIP-seq
MIRT2576214	hsa-miR-632	CLIP-seq
MIRT2576215	hsa-miR-635	CLIP-seq
MIRT2277314	hsa-miR-646	CLIP-seq
MIRT2576216	hsa-miR-660	CLIP-seq
MIRT2277315	hsa-miR-668	CLIP-seq
MIRT2576217	hsa-miR-711	CLIP-seq
MIRT2576218	hsa-miR-767-3p	CLIP-seq
MIRT2576146	hsa-miR-1184	CLIP-seq
MIRT2576147	hsa-miR-1205	CLIP-seq
MIRT2277301	hsa-miR-1236	CLIP-seq
MIRT2576148	hsa-miR-1245b-3p	CLIP-seq
MIRT2576149	hsa-miR-140-3p	CLIP-seq
MIRT2576150	hsa-miR-147	CLIP-seq
MIRT2685626	hsa-miR-1587	CLIP-seq
MIRT2576151	hsa-miR-183	CLIP-seq
MIRT2576152	hsa-miR-185	CLIP-seq
MIRT2576153	hsa-miR-188-5p	CLIP-seq
MIRT2576154	hsa-miR-2110	CLIP-seq
MIRT1167947	hsa-miR-2355-5p	CLIP-seq
MIRT2048436	hsa-miR-298	CLIP-seq
MIRT2576155	hsa-miR-302f	CLIP-seq
MIRT2576156	hsa-miR-3144-5p	CLIP-seq
MIRT2277303	hsa-miR-3147	CLIP-seq
MIRT2576157	hsa-miR-3150a-3p	CLIP-seq
MIRT2277304	hsa-miR-3158-5p	CLIP-seq
MIRT2576158	hsa-miR-3160-3p	CLIP-seq
MIRT2277306	hsa-miR-3183	CLIP-seq
MIRT2576159	hsa-miR-3189-3p	CLIP-seq
MIRT2576160	hsa-miR-3191	CLIP-seq
MIRT2576161	hsa-miR-3192	CLIP-seq
MIRT2576162	hsa-miR-3194-3p	CLIP-seq
MIRT2277307	hsa-miR-320e	CLIP-seq
MIRT2576163	hsa-miR-326	CLIP-seq
MIRT2576164	hsa-miR-330-5p	CLIP-seq
MIRT2576165	hsa-miR-346	CLIP-seq
MIRT1167953	hsa-miR-3646	CLIP-seq
MIRT1167954	hsa-miR-3660	CLIP-seq
MIRT2576166	hsa-miR-3667-5p	CLIP-seq
MIRT2576167	hsa-miR-3689a-3p	CLIP-seq
MIRT2576168	hsa-miR-3689c	CLIP-seq
MIRT2576169	hsa-miR-3689d	CLIP-seq
MIRT2576170	hsa-miR-3925-5p	CLIP-seq
MIRT2576171	hsa-miR-3937	CLIP-seq
MIRT2576172	hsa-miR-4288	CLIP-seq
MIRT2576173	hsa-miR-4289	CLIP-seq
MIRT2576174	hsa-miR-4293	CLIP-seq
MIRT2576175	hsa-miR-4306	CLIP-seq
MIRT2576176	hsa-miR-4314	CLIP-seq
MIRT2576177	hsa-miR-4419a	CLIP-seq
MIRT2576178	hsa-miR-4428	CLIP-seq
MIRT2685627	hsa-miR-4492	CLIP-seq
MIRT2576179	hsa-miR-4496	CLIP-seq
MIRT2685628	hsa-miR-4498	CLIP-seq
MIRT2277309	hsa-miR-4503	CLIP-seq
MIRT2685629	hsa-miR-4505	CLIP-seq
MIRT2576180	hsa-miR-4510	CLIP-seq
MIRT1167965	hsa-miR-4526	CLIP-seq
MIRT2576181	hsa-miR-4533	CLIP-seq
MIRT2576182	hsa-miR-4633-3p	CLIP-seq
MIRT2685630	hsa-miR-4640-5p	CLIP-seq
MIRT2576183	hsa-miR-4644	CLIP-seq
MIRT2576184	hsa-miR-4646-5p	CLIP-seq
MIRT2576185	hsa-miR-4652-5p	CLIP-seq
MIRT2685631	hsa-miR-4656	CLIP-seq
MIRT2277310	hsa-miR-4660	CLIP-seq
MIRT2576186	hsa-miR-4661-3p	CLIP-seq
MIRT2685632	hsa-miR-4674	CLIP-seq
MIRT2685633	hsa-miR-4675	CLIP-seq
MIRT2576187	hsa-miR-4690-3p	CLIP-seq
MIRT2576188	hsa-miR-4711-3p	CLIP-seq
MIRT2576189	hsa-miR-4712-3p	CLIP-seq
MIRT2576190	hsa-miR-4713-5p	CLIP-seq
MIRT2277311	hsa-miR-4723-3p	CLIP-seq
MIRT2685634	hsa-miR-4726-5p	CLIP-seq
MIRT2576191	hsa-miR-4728-5p	CLIP-seq
MIRT2685635	hsa-miR-4741	CLIP-seq
MIRT2576192	hsa-miR-4747-5p	CLIP-seq
MIRT2576193	hsa-miR-4755-3p	CLIP-seq
MIRT2576194	hsa-miR-4761-5p	CLIP-seq
MIRT2576195	hsa-miR-4773	CLIP-seq
MIRT1167975	hsa-miR-4793-5p	CLIP-seq
MIRT2576196	hsa-miR-4800-5p	CLIP-seq
MIRT2277313	hsa-miR-493	CLIP-seq
MIRT2576197	hsa-miR-544b	CLIP-seq
MIRT2576198	hsa-miR-548a-5p	CLIP-seq
MIRT2576199	hsa-miR-548ab	CLIP-seq
MIRT2576200	hsa-miR-548ak	CLIP-seq
MIRT2576201	hsa-miR-548b-5p	CLIP-seq
MIRT2576202	hsa-miR-548c-5p	CLIP-seq
MIRT2576203	hsa-miR-548d-5p	CLIP-seq
MIRT2576204	hsa-miR-548h	CLIP-seq
MIRT2576205	hsa-miR-548i	CLIP-seq
MIRT2576206	hsa-miR-548j	CLIP-seq
MIRT2576207	hsa-miR-548k	CLIP-seq
MIRT2576208	hsa-miR-548l	CLIP-seq
MIRT2576209	hsa-miR-548w	CLIP-seq
MIRT2576210	hsa-miR-548y	CLIP-seq
MIRT1167976	hsa-miR-552	CLIP-seq
MIRT2576211	hsa-miR-559	CLIP-seq
MIRT2576212	hsa-miR-591	CLIP-seq
MIRT2576213	hsa-miR-615-5p	CLIP-seq
MIRT2576214	hsa-miR-632	CLIP-seq
MIRT2576215	hsa-miR-635	CLIP-seq
MIRT2277314	hsa-miR-646	CLIP-seq
MIRT2576216	hsa-miR-660	CLIP-seq
MIRT2277315	hsa-miR-668	CLIP-seq
MIRT2576217	hsa-miR-711	CLIP-seq
MIRT2685636	hsa-miR-762	CLIP-seq
MIRT2576218	hsa-miR-767-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
STAT3	Unknown	12244150

134

Show/Hide all (134)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002238	Process	Response to molecule of fungal origin	IEA
GO:0002269	Process	Leukocyte activation involved in inflammatory response	IEA
GO:0002283	Process	Neutrophil activation involved in immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005121	Function	Toll binding	IEA
GO:0005123	Function	Death receptor binding	TAS	9374458
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	10880445, 11544529, 12860405, 15728506, 16189514, 16293622, 16365431, 17126326, 17258210, 17567694, 17583698, 19948740, 20485341, 20676093, 20696886, 21334391, 21829704, 21988832, 22155231, 22581261, 23143332, 24316379, 25416956, 25502805, 25910212, 26592460, 26752465, 26871637, 285
GO:0005634	Component	Nucleus	IDA	22155231
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	9430229
GO:0005737	Component	Cytoplasm	IDA	22155231
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16751103
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006909	Process	Phagocytosis	IMP	30883606
GO:0006915	Process	Apoptotic process	IMP	22155231
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	NAS	9013863
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9374458
GO:0007254	Process	JNK cascade	IEA
GO:0007254	Process	JNK cascade	IEA
GO:0008063	Process	Toll signaling pathway	IBA
GO:0008063	Process	Toll signaling pathway	IEA
GO:0009615	Process	Response to virus	IEA
GO:0009682	Process	Induced systemic resistance	IEA
GO:0009986	Component	Cell surface	IDA	22851693
GO:0010008	Component	Endosome membrane	TAS
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0014004	Process	Microglia differentiation	IEA
GO:0014075	Process	Response to amine	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019897	Component	Extrinsic component of plasma membrane	IDA	9430229
GO:0022008	Process	Neurogenesis	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IDA	16751103
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IEA
GO:0032481	Process	Positive regulation of type I interferon production	IMP	23633945
GO:0032494	Process	Response to peptidoglycan	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0032675	Process	Regulation of interleukin-6 production	IEA
GO:0032680	Process	Regulation of tumor necrosis factor production	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	33718825
GO:0032740	Process	Positive regulation of interleukin-17 production	IEA
GO:0032740	Process	Positive regulation of interleukin-17 production	ISS
GO:0032747	Process	Positive regulation of interleukin-23 production	IEA
GO:0032747	Process	Positive regulation of interleukin-23 production	ISS
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	20219467
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IBA
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IC	35977521
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	7479976, 17878161, 25355951, 25371197, 26189595
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	16751103
GO:0034143	Process	Regulation of toll-like receptor 4 signaling pathway	IDA	19289601
GO:0034146	Process	Toll-like receptor 5 signaling pathway	IDA	16751103
GO:0034158	Process	Toll-like receptor 8 signaling pathway	IDA	33718825
GO:0035325	Function	Toll-like receptor binding	IBA
GO:0035325	Function	Toll-like receptor binding	IEA
GO:0035591	Function	Signaling adaptor activity	IDA	16751103
GO:0035591	Function	Signaling adaptor activity	IEA
GO:0038061	Process	Non-canonical NF-kappaB signal transduction	IDA	12048232, 26189595
GO:0038124	Process	Toll-like receptor TLR6:TLR2 signaling pathway	IDA	27708357
GO:0038124	Process	Toll-like receptor TLR6:TLR2 signaling pathway	IDA	36964784
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	11960013, 20532808
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IDA	18802081
GO:0038172	Process	Interleukin-33-mediated signaling pathway	IMP	31435003
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042742	Process	Defense response to bacterium	IMP	20219467
GO:0042802	Function	Identical protein binding	IPI	11544529, 17258210, 21516116, 21988832, 22155231, 25416956, 25910212, 27107012, 29892012, 32296183
GO:0042832	Process	Defense response to protozoan	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043200	Process	Response to amino acid	IEA
GO:0043588	Process	Skin development	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IEA
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050727	Process	Regulation of inflammatory response	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IBA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IMP	22155231
GO:0051607	Process	Defense response to virus	IDA	33718825
GO:0051607	Process	Defense response to virus	IEA
GO:0060090	Function	Molecular adaptor activity	IDA	9430229, 9734363, 16751103
GO:0060337	Process	Type I interferon-mediated signaling pathway	IMP	23633945
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	14625308, 20485341
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IDA	9430229
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IEA
GO:0070555	Process	Response to interleukin-1	IMP	19281832
GO:0070935	Process	3'-UTR-mediated mRNA stabilization	IDA	15294994
GO:0070944	Process	Neutrophil-mediated killing of bacterium	IEA
GO:0070976	Function	TIR domain binding	IEA
GO:0070976	Function	TIR domain binding	IPI	19509286
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0090557	Process	Establishment of endothelial intestinal barrier	IEA
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	IEA
GO:0140052	Process	Cellular response to oxidised low-density lipoprotein particle stimulus	ISS
GO:0140674	Function	ATP-dependent histone chaperone activity	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IEA
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IMP	20219467
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	ISS
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IMP	33718825
GO:1902622	Process	Regulation of neutrophil migration	IEA
GO:2000338	Process	Regulation of chemokine (C-X-C motif) ligand 1 production	IEA
GO:2000341	Process	Regulation of chemokine (C-X-C motif) ligand 2 production	IEA

MIM	HGNC	e!Ensembl
602170	7562	ENSG00000172936

Q99836

Protein name

Myeloid differentiation primary response protein MyD88

Protein function

Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response (PubMed:15361868, PubMed:18292575, PubMed:33718825, PubMed:37971847). Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa

PDB

2JS7 , 2Z5V , 3MOP , 4DOM , 4EO7 , 6I3N , 7BEQ , 7BER , 7L6W , 8S78 , 8W8M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00531	Death	30 → 107	Death domain	Domain
PF01582	TIR	163 → 295	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:8957090}.

Sequence

MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLE
IRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQ
QQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIR
QLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFA
LSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP

Sequence length

296

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Pyogenic bacterial infections due to MyD88 deficiency	Pathogenic; Likely pathogenic	rs765198848, rs2125777824, rs2471593660, rs137853065, rs878852993	RCV001784687 RCV002016128 RCV003066168 RCV000007925 RCV000007923	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHOLESTASIS, EXTRAHEPATIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSED MOOD	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 68	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, FOLLICULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Macroglobulinemia, Waldenstrom, somatic	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYD88-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WALDENSTROM MACROGLOBULINEMIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (377)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
5q-syndrome	5q-syndrome	BEFREE	25159121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29788922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	19732721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	21274885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	23380077, 24444466, 25768255, 25900979, 27923841, 28496180, 28803429, 28847710, 29358175, 29871863, 31123031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	19745833, 23666053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amelogenesis imperfecta nephrocalcinosis	Amelogenesis Imperfecta	BEFREE	30979838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	25819228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	15883205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28938189		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	25766528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	22964479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	22051943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	22051943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	29029533		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15249654, 16960501, 29036304, 29622163, 30120976, 30674322, 30880215, 31580158, 31597445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthralgia	Arthralgia	Pubtator	28381754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17255320, 31320744, 36405992, 36614150, 37749630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21389010, 29728508, 31258683, 31825792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35190755	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37717070, 38367422	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asymmetric Septal Hypertrophy	Septal Hypertrophy	BEFREE	28878132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15249654, 16960501, 29036304, 29622163, 30120976, 30674322, 30880215, 31580158, 31597445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34020127, 36733418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29595637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	29595637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23521885, 24379120, 26794091, 27521268, 28611775, 28951424, 29118245, 29757592, 30250175, 30860380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26794091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23955458, 25216226, 25819228, 25900979, 26230596, 26297301, 26454445, 27268124, 27837631, 27890075, 29061802, 30253331, 30324684, 31278738		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	23419703, 26136429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30939216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	24553177, 25216226, 27301862, 28983055, 35877223, 36210485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	27301862, 28294689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Abscess	Brain Abscess	BEFREE	21496301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18922969, 21079774, 22088941, 26261595, 26596839, 30015868, 30066873, 30878390, 31259152, 31287789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25360699, 26261595, 26299331, 30015868, 30066873, 30157918, 35102665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopneumonia	Bronchopneumonia	Pubtator	33719773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	Pubtator	25160558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	BEFREE	18591412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	26332828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carbamoyl-Phosphate Synthase I Deficiency Disease	Carbamoyl Phosphate Synthase Deficiency	BEFREE	22466646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23569218, 35910766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22088941, 23235763, 24977712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	24977712	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26985932, 34435646, 36793272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30939216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22938463, 25175786, 26596839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17940625, 19619321, 22533866, 22985132, 24452475, 24977712, 27118139, 27460076, 27708225, 29502561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	25766528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33637109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19826413, 24403249, 24452475, 25308861, 25451316, 25681684, 26223974, 27460076, 28012060, 28013349, 29343281, 29502561, 31019941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic Familial	Cardiomyopathy	Pubtator	35609334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	16456012, 18485912, 23658628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	37997571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	30353605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	31432179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	29622163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis, Extrahepatic	Cholestasis	CTD_human_DG	28789951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Disease	Chronic disease	Pubtator	33637950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	28684198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	21642962, 22150006, 23178471, 23419703, 24103588, 24782504, 24943832, 24943833, 24992174, 25819228, 26136429, 26181643, 26230596, 27840426, 27959900 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26498252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Q Fever	Q Fever	BEFREE	25722298		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29930295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	26332828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cold Hemagglutinin Disease	Autoimmune hemolytic anemia	BEFREE	25819228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16952555, 23636052, 24603458, 28153604, 29898958, 31628426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Microscopic	Microscopic colitis	Pubtator	27672296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18538140, 23766530, 28417458, 30001768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24154872, 24603458, 24887488, 28753429, 28815730, 30086464, 30221070, 31659096, 31746347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20145615, 30239551, 31659096, 34626022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	29757592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	29757592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	27742074, 27840426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	37951851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	26959040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26959040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26959040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	26959040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	24146036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Critical Illness	Critical illness	Pubtator	37567916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	20353899, 31268627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutis marmorata	Cutis marmorata	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	14656745, 15661927, 18684966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	15661927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16319097, 31435813, 31606726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	35577568, 35798560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	24168294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	36496170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	36496170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	23499488, 29120743, 30038386, 30240702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	21399862, 28383552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28410990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20824098, 28830942, 29960834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	27340831, 33019392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20824098, 28830942, 29960834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35504843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32273829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20067962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29960834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27062898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	29522531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27062898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28381754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	22808296, 23178471, 23380077, 24444466, 24491438, 25347427, 25768255, 25900979, 25978699, 26111727, 26388135, 26747248, 26757737, 26773040, 26792260 View all (27 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	25049379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	31611734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	31611734, 34400791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	23169882	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	30025110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	30139760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	24845156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	21399862, 28383552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	CTD_human_DG	26882889		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilia, Tropical	Eosinophilia	CTD_human_DG	26882889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epididymitis	Epididymitis	BEFREE	27218225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies Partial	Partial epilepsy	Pubtator	27915469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28529112, 29380367, 30112701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28529112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	24403249, 25681684, 27460076, 28012060, 29502561, 31019941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	30484894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31293986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31293986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Waldenstrom`s Macroglobulinaemia	Waldenstrom`s Macroglobulinemia	CTD_human_DG	30126942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	24997224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	24997224, 28038359, 28878132, 28931589, 30770929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	26261595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27135246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric lymphoma	Gastric lymphoma	BEFREE	29931605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	22524533	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21705839, 33735913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26111727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34134771, 34643804, 36325335, 37456890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	21808234, 24379120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32388684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	26442657, 30317551, 30501537, 30619630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	27121112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	25712126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	16216974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36733418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23235763, 24153350, 24887488, 26942591, 30301877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	30301877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	27890075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	24997224	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	34435646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	35937947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	25889448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	19745833, 23666053, 25978699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	29973931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	25610879, 26959040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25610879	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	26959040, 27340831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	25359991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	26959040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	CTD_human_DG	27292124		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	29178049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotrichosis simplex	Hypotrichosis simplex	BEFREE	20945369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Inflammatory Myopathies	Inflammatory Myopathy	BEFREE	22964787		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	18776126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29310107, 30668369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	34778800, 40397075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	28733486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17133100, 30949903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29120743, 30038386, 30240702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27340831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29115481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	36213280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrinsic Factor Deficiency	Intrinsic Factor Deficiency	BEFREE	31845221		★★★★★ ★☆☆☆☆ Found in Text Mining only
IRAK4 Deficiency	IRAK4 Deficiency	BEFREE	23255009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29556203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	16926427, 27528076, 29675369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28805489		★★★★★ ★☆☆☆☆ Found in Text Mining only
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	28359290		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26230596, 29061802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37730436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	33217360, 37137530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31845221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21750200, 23549880, 24603331, 28370778, 28875549, 29022910, 29916535, 30770929, 31074165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	27135246, 34435646	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	29147012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28836991, 29658361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35910766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	23499488, 28951424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	23497717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	34928926	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	23499488, 28951424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23499488, 28951424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	23499488, 28951424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphadenitis	Lymphadenitis	BEFREE	31301515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26600481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26600481, 30066873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	23446312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	21179087, 22698399, 22837180, 22944768, 23380077, 23532735, 24153350, 24444466, 24992174, 25359991, 25696843, 25768255, 25900979, 25978699, 26111727 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	21179087, 22931316, 23976989, 24970810, 25216226, 25359991, 25819228, 25900979, 26230596, 26702065, 27503954, 27915469, 28381754, 28636991, 29151258 View all (41 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	37953776	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	24362818, 37493986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	CTD_human_DG	24362818		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Follicular	Lymphoma	BEFREE	31576141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, Follicular, Grade 1	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 2	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 3	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	28280994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Mixed-Cell, Follicular	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28280994, 28405493, 29433938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28280994, 29433938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Cleaved-Cell, Follicular	Lymphoma	CTD_human_DG	24362818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	23499488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	23446312, 23955458, 24143001, 24573383, 24842316, 24992174, 26792260, 31276195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	26482097, 31276195	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MACROGLOBULINEMIA, WALDENSTROM, SUSCEPTIBILITY TO, 1	Waldenstrom`s Macroglobulinemia	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	25712126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18922969, 21079774, 22088941, 26261595, 26596839, 30015868, 30066873, 30878390, 31259152, 31287789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31293986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22938463, 25175786, 26596839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19826413, 25308861, 25451316, 26223974, 28013349, 29343281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30666818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23235763, 26700889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30939216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23235763, 23471913, 23766530, 23976989, 24285099, 24573741, 24977712, 25547486, 26792260, 27143257, 27840426, 27923841, 28002793, 28011934, 28294689 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18538140, 23766530, 28417458, 30001768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22031535, 26261595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	22915070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	22944768, 24767771, 25723115, 25819228, 25972321, 26230596, 30198568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19001446, 20302635, 32312954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20302635, 28662055, 31175545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	24168294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	33637950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	28075222	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20824098, 28075222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microscopic Polyangiitis	Microscopic polyangiitis	Pubtator	39672520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37635482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	23321251, 24509637, 25159121, 28280994, 31483817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal immunoglobulin M proteinemia	Monoclonal immunoglobulin M proteinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	25780885, 34290221, 40367231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	22944768, 24767771, 25216226, 25723115, 28280994, 28682481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	17363736, 29181840, 29318955, 36752202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22931316, 23321251, 23955458, 24224040, 30868035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23950974, 29930295, 30310937, 31036429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30010933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	37975358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	BEFREE	17997408, 22051943, 27625307, 28642279, 29568058, 30802297		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	ORPHANET_DG	18669862		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	UNIPROT_DG	18669862, 19506249, 21057262, 24316379		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	GENOMICS_ENGLAND_DG	23215570		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23976989, 25159121, 31268627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndrome with Isolated del(5q)	Myelodysplastic syndrome	BEFREE	25159121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23976989, 29080258, 37172199, 40397075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelokathexis	Myelokathexis	BEFREE	24366360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29524303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29940584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	29158520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	BEFREE	25968578, 28911136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	23157229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	25665053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18538140, 19158483, 19318560, 19826413, 20823152, 22088941, 22837180, 22931316, 22938463, 23184679, 23355535, 23549880, 23720088, 23955458, 24216477 View all (34 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	23499488, 28849172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	25879763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	34415075	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	31301515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	29067999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	24351080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	26600481, 31432177		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	28346354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	24997224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Normocytic anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19808018, 20824098, 25476696, 28614714, 29636416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28075222, 32188105, 33637950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31320744	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	31272370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35992546, 37393232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	29940143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	30663793, 31345099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	37635482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	30978245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29289808, 29995146, 30978245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30250559		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17940625		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19826413, 25308861, 25451316, 26223974, 28013349, 29343281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	17940625, 19826413, 26223974, 29502561, 33370338	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30666818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36232715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	16216974, 22908323, 29157809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	30979838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraproteinemias	Paraproteinemia	BEFREE	25723115, 27734522, 31591468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	17652449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29670828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	30027272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29995146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	26581717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	27107801, 27739344, 30716373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	27981790	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	31588566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	31588566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	34448823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	31556196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	28446897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	28280994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	17448566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	24970810, 26111727, 26757737, 29151258, 29210102, 29222305, 29258950, 29891112, 30171453, 30227305, 30353605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	23355535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28339016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	26498252	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33590951	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	24205107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Eosinophilia	Pulmonary Eosinophilia	CTD_human_DG	29067999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28662409, 28725012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	29658361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31261506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16319097, 26782542, 27574922, 29442025, 30286793, 31320744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	35190755	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rigid spine syndrome	Rigid spine muscular dystrophy	Pubtator	24997224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	23666053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	26468534	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	32932517, 37730436, 40507898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27070349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schnitzler Syndrome	Schnitzler Syndrome	BEFREE	31268627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	38166692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	19181857, 21219635, 24747744, 26790027, 28482922, 28599094, 28733486, 28796387, 29717063, 30957795, 31210339, 31427815, 31524226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	28640392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	29864926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	28843295	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Simple Pulmonary Eosinophilia	Pulmonary Eosinophilia	CTD_human_DG	29067999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30446998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	32488284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28339016, 30099194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 6 (disorder)	Spinocerebellar Ataxia	BEFREE	26034136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	23532735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22583829, 33637109	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	15883205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	30112701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26700889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26700889, 29330337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29150630, 29249938, 31803007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	21525878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	27915469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	40675955	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboangiitis Obliterans	Thromboangiitis obliterans	Pubtator	38640750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombophilia	Thrombophilia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	29595637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	24603331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	20039900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	28363255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Toxic Shock Syndrome	Toxic Shock Syndrome	BEFREE	20699281, 29049365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	35789992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21221801, 23636052, 24189845, 29404307, 30477744, 30915760, 31378906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	26195555, 30027272, 30204732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	28864202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	22931316, 22944768, 23321251, 23355535, 23446312, 23473949, 23477936, 23532735, 23723443, 23836557, 23955458, 24143001, 24153350, 24224040, 24366360 View all (70 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	22931316, 23321251, 23355535, 23532735, 23723443, 23836557, 24224040, 24366360, 24553177, 24786453, 24895570, 25160558, 25341731, 25371371, 25853747 View all (48 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	ORPHANET_DG	23321251, 23532735		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	CTD_human_DG	30126942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	CGI_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
	Waldenstrom`s Macroglobulinemia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WHIM syndrome	Whim syndrome	Pubtator	24553177, 25819228, 26002963, 26659815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MYD88 (MYD88 innate immune signal transduction adaptor)