MYC (MYC proto-oncogene, bHLH transcription factor)

Gene

• Entrez ID: 4609
• Gene name: MYC proto-oncogene, bHLH transcription factor
• Gene symbol: MYC
• Synonyms (NCBI Gene): MRTL, MYCC, bHLHe39, c-Myc
• Chromosome: 8
• Chromosome location: 8q24.21
• Summary: This gene is a proto-oncogene and encodes a nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. The encoded protein forms a heterodimer with the related transcription factor MAX. This complex binds to

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28933407	C>T	Pathogenic	Coding sequence variant, missense variant
rs121918683	A>C	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs121918684	G>C	Pathogenic	Missense variant, coding sequence variant
rs121918685	C>G	Pathogenic	Missense variant, coding sequence variant
rs750664148	A>C,G	Likely-pathogenic	Missense variant, coding sequence variant
rs756091827	C>G,T	Likely-pathogenic	Missense variant, coding sequence variant
rs775522201	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519849	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519850	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519851	C>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1057519918	C>T	Likely-pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Luciferase reporter assay	17877811
MIRT003748	hsa-let-7c-5p	Western blot	17877811
MIRT003748	hsa-let-7c-5p	Northern blot	17877811
MIRT004290	hsa-miR-145-5p	qRT-PCR, Luciferase reporter assay, Western blot	19202062
MIRT004290	hsa-miR-145-5p	qRT-PCR, Luciferase reporter assay, Western blot	19202062
MIRT003438	hsa-miR-98-5p	Luciferase reporter assay	19528081
MIRT003438	hsa-miR-98-5p	Northern blot	19528081
MIRT003438	hsa-miR-98-5p	qRT-PCR	19528081
MIRT003438	hsa-miR-98-5p	ChIP	19528081
MIRT004307	hsa-miR-21-5p	Northern blot	19528081
MIRT004307	hsa-miR-21-5p	qRT-PCR	19528081
MIRT004307	hsa-miR-21-5p	ChIP	19528081
MIRT004401	hsa-miR-34b-5p	Review, Luciferase reporter assay	19461653
MIRT004402	hsa-miR-34c-5p	Review, Luciferase reporter assay	19461653
MIRT000695	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	19696787
MIRT000475	hsa-let-7g-5p	qRT-PCR, Luciferase reporter assay, Western blot	20309945
MIRT000417	hsa-let-7a-5p	Review	20144549
MIRT003438	hsa-miR-98-5p	Review	20130964
MIRT000417	hsa-let-7a-5p	Review	20179807
MIRT000417	hsa-let-7a-5p	Western blot	20033209
MIRT000121	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT000121	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT000121	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT000121	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	19748357
MIRT005288	hsa-miR-17-5p	Western blot	18695042
MIRT005289	hsa-miR-20a-5p	Western blot	18695042
MIRT005319	hsa-miR-34b-3p	Luciferase reporter assay, Western blot	18768788
MIRT005319	hsa-miR-34b-3p	Luciferase reporter assay, Western blot	18768788
MIRT005319	hsa-miR-34b-3p	Immunohistochemistry, qRT-PCR	18802929
MIRT000417	hsa-let-7a-5p	qRT-PCR, Western blot	16651716
MIRT003968	hsa-miR-26a-5p	Western blot	19524505
MIRT000417	hsa-let-7a-5p	qRT-PCR	17942906
MIRT003438	hsa-miR-98-5p	qRT-PCR	17942906
MIRT005482	hsa-miR-378a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	21242960
MIRT000695	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21294122
MIRT004290	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	21092188
MIRT006015	hsa-miR-371a-3p	In situ hybridization, Microarray, qRT-PCR	21059911
MIRT006016	hsa-miR-373-3p	In situ hybridization, Microarray, qRT-PCR, Western blot	21059911
MIRT000695	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006015	hsa-miR-371a-3p	In situ hybridization, Microarray, qRT-PCR	21059911
MIRT006016	hsa-miR-373-3p	In situ hybridization, Microarray, qRT-PCR, Western blot	21059911
MIRT000695	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006015	hsa-miR-371a-3p	In situ hybridization, Microarray, qRT-PCR	21059911
MIRT006016	hsa-miR-373-3p	In situ hybridization, Microarray, qRT-PCR, Western blot	21059911
MIRT000695	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT006358	hsa-miR-451a	Luciferase reporter assay	21464222
MIRT000695	hsa-miR-34a-5p	Luciferase reporter assay	22159222
MIRT006820	hsa-miR-33b-5p	Immunohistochemistry, qRT-PCR	22887866
MIRT007105	hsa-miR-135a-5p	Luciferase reporter assay, Western blot	23176581
MIRT007308	hsa-miR-449c-5p	Luciferase reporter assay	23507140
MIRT007308	hsa-miR-449c-5p	Luciferase reporter assay	23507140
MIRT016647	hsa-miR-429	Reporter assay;Western blot;Other	21684154
MIRT017925	hsa-miR-335-5p	Microarray	18185580
MIRT017925	hsa-miR-335-5p	Western blot	21618216
MIRT000475	hsa-let-7g-5p	qRT-PCR	21618519
MIRT000475	hsa-let-7g-5p	Western blot;qRT-PCR;Other	20309945
MIRT000695	hsa-miR-34a-5p	Sequencing	20371350
MIRT000695	hsa-miR-34a-5p	Reporter assay;Western blot;qRT-PCR;Microarray;Other	19696787
MIRT003438	hsa-miR-98-5p	Microarray	19088304
MIRT000121	hsa-miR-24-3p	Reporter assay;qRT-PCR;Microarray;Other	19748357
MIRT032089	hsa-let-7f-5p	qRT-PCR	19956384
MIRT052217	hsa-let-7b-5p	CLASH	23622248
MIRT005288	hsa-miR-17-5p	CLASH	23622248
MIRT044759	hsa-miR-320a	CLASH	23622248
MIRT044759	hsa-miR-320a	CLASH	23622248
MIRT038140	hsa-miR-423-5p	CLASH	23622248
MIRT037690	hsa-miR-744-5p	CLASH	23622248
MIRT036232	hsa-miR-320b	CLASH	23622248
MIRT004290	hsa-miR-145-5p	qRT-PCR, Western blot	23710609
MIRT053199	hsa-miR-148a-3p	Immunoblot, Microarray, qRT-PCR	23389829
MIRT053469	hsa-miR-212-3p	Luciferase reporter assay, qRT-PCR, Western blot	21053104
MIRT053756	hsa-miR-494-3p	Luciferase reporter assay, qRT-PCR, Western blot	24612089
MIRT053756	hsa-miR-494-3p	Luciferase reporter assay, qRT-PCR, Western blot	24612089
MIRT053756	hsa-miR-494-3p	Luciferase reporter assay, qRT-PCR, Western blot	24612089
MIRT053756	hsa-miR-494-3p	Luciferase reporter assay, qRT-PCR, Western blot	24612089
MIRT053756	hsa-miR-494-3p	Luciferase reporter assay, qRT-PCR, Western blot	24612089
MIRT053756	hsa-miR-494-3p	Luciferase reporter assay, qRT-PCR, Western blot	24612089
MIRT054028	hsa-miR-155-5p	Luciferase reporter assay, qRT-PCR, Western blot	24969405
MIRT005319	hsa-miR-34b-3p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22585994
MIRT004402	hsa-miR-34c-5p	Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22585994
MIRT054238	hsa-miR-33a-5p	Immunoflourescence, Luciferase reporter assay, qRT-PCR, Western blot	23527086
MIRT006358	hsa-miR-451a	Luciferase reporter assay	25310895
MIRT006358	hsa-miR-451a	Luciferase reporter assay	25310895
MIRT037690	hsa-miR-744-5p	Luciferase reporter assay, Immunohistochemistry, Western blot	24991193
MIRT437853	hsa-miR-487b-3p	ChIP-seq, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23426183
MIRT438802	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438802	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438801	hsa-miR-19a-3p	qRT-PCR	24955218
MIRT438801	hsa-miR-19a-3p	qRT-PCR	24955218
MIRT005289	hsa-miR-20a-5p	qRT-PCR	24955218
MIRT005289	hsa-miR-20a-5p	qRT-PCR	24955218
MIRT438037	hsa-miR-93-5p	qRT-PCR	24955218
MIRT438037	hsa-miR-93-5p	qRT-PCR	24955218
MIRT438800	hsa-miR-19b-1-5p	qRT-PCR	24955218
MIRT438800	hsa-miR-19b-1-5p	qRT-PCR	24955218
MIRT438799	hsa-miR-19b-2-5p	qRT-PCR	24955218
MIRT438799	hsa-miR-19b-2-5p	qRT-PCR	24955218
MIRT438798	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438798	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438797	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438797	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438796	hsa-miR-25-3p	qRT-PCR	24955218
MIRT438796	hsa-miR-25-3p	qRT-PCR	24955218
MIRT438621	hsa-miR-126-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22972034
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438063	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438037	hsa-miR-93-5p	qRT-PCR	24367666
MIRT437962	hsa-miR-7-5p	qRT-PCR	24707474
MIRT438802	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438802	hsa-miR-106b-5p	qRT-PCR	24955218
MIRT438801	hsa-miR-19a-3p	qRT-PCR	24955218
MIRT438801	hsa-miR-19a-3p	qRT-PCR	24955218
MIRT005289	hsa-miR-20a-5p	qRT-PCR	24955218
MIRT005289	hsa-miR-20a-5p	qRT-PCR	24955218
MIRT438037	hsa-miR-93-5p	qRT-PCR	24955218
MIRT438037	hsa-miR-93-5p	qRT-PCR	24955218
MIRT438800	hsa-miR-19b-1-5p	qRT-PCR	24955218
MIRT438800	hsa-miR-19b-1-5p	qRT-PCR	24955218
MIRT438799	hsa-miR-19b-2-5p	qRT-PCR	24955218
MIRT438799	hsa-miR-19b-2-5p	qRT-PCR	24955218
MIRT438798	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438798	hsa-miR-92a-1-5p	qRT-PCR	24955218
MIRT438797	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438797	hsa-miR-92a-2-5p	qRT-PCR	24955218
MIRT438796	hsa-miR-25-3p	qRT-PCR	24955218
MIRT438796	hsa-miR-25-3p	qRT-PCR	24955218
MIRT438621	hsa-miR-126-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22972034
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438154	hsa-miR-184	Luciferase reporter assay	24157866
MIRT438063	hsa-miR-324-3p	qRT-PCR	24367666
MIRT438037	hsa-miR-93-5p	qRT-PCR	24367666
MIRT437962	hsa-miR-7-5p	qRT-PCR	24707474
MIRT224345	hsa-miR-6507-3p	HITS-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	HITS-CLIP	21572407
MIRT105107	hsa-miR-2682-5p	HITS-CLIP	21572407
MIRT004401	hsa-miR-34b-5p	HITS-CLIP	21572407
MIRT007308	hsa-miR-449c-5p	HITS-CLIP	21572407
MIRT499108	hsa-miR-889-5p	HITS-CLIP	21572407
MIRT007105	hsa-miR-135a-5p	HITS-CLIP	21572407
MIRT499107	hsa-miR-135b-5p	HITS-CLIP	21572407
MIRT499106	hsa-miR-622	HITS-CLIP	21572407
MIRT105105	hsa-miR-1827	HITS-CLIP	21572407
MIRT105108	hsa-miR-548au-3p	HITS-CLIP	21572407
MIRT105112	hsa-miR-8074	HITS-CLIP	21572407
MIRT499105	hsa-miR-6765-5p	HITS-CLIP	21572407
MIRT105104	hsa-miR-1304-5p	HITS-CLIP	21572407
MIRT105097	hsa-miR-30a-3p	HITS-CLIP	21572407
MIRT105098	hsa-miR-30d-3p	HITS-CLIP	21572407
MIRT105099	hsa-miR-30e-3p	HITS-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT499108	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT499106	hsa-miR-622	PAR-CLIP	20371350
MIRT105105	hsa-miR-1827	PAR-CLIP	20371350
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT105112	hsa-miR-8074	PAR-CLIP	20371350
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT550567	hsa-miR-3133	PAR-CLIP	20371350
MIRT550566	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT105113	hsa-miR-4426	PAR-CLIP	20371350
MIRT105114	hsa-miR-4647	PAR-CLIP	20371350
MIRT105115	hsa-miR-4662b	PAR-CLIP	20371350
MIRT550565	hsa-miR-4762-5p	PAR-CLIP	20371350
MIRT550564	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT499108	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT105105	hsa-miR-1827	PAR-CLIP	20371350
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT105112	hsa-miR-8074	PAR-CLIP	20371350
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	21572407
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT499108	hsa-miR-889-5p	PAR-CLIP	21572407
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	21572407
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	21572407
MIRT499106	hsa-miR-622	PAR-CLIP	21572407
MIRT105105	hsa-miR-1827	PAR-CLIP	21572407
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	21572407
MIRT105112	hsa-miR-8074	PAR-CLIP	21572407
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	21572407
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	21572407
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT550567	hsa-miR-3133	PAR-CLIP	21572407
MIRT550566	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT105113	hsa-miR-4426	PAR-CLIP	21572407
MIRT105114	hsa-miR-4647	PAR-CLIP	21572407
MIRT105115	hsa-miR-4662b	PAR-CLIP	21572407
MIRT550565	hsa-miR-4762-5p	PAR-CLIP	21572407
MIRT550564	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	24398324
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	24398324
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	24398324
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	24398324
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	24398324
MIRT499108	hsa-miR-889-5p	PAR-CLIP	24398324
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	24398324
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	24398324
MIRT499106	hsa-miR-622	PAR-CLIP	24398324
MIRT105105	hsa-miR-1827	PAR-CLIP	24398324
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	24398324
MIRT105112	hsa-miR-8074	PAR-CLIP	24398324
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	24398324
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	24398324
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	24398324
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	24398324
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	24398324
MIRT105126	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT454977	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT454976	hsa-miR-4699-3p	PAR-CLIP	23592263
MIRT105124	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT105125	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT454975	hsa-miR-3919	PAR-CLIP	23592263
MIRT105121	hsa-miR-4289	PAR-CLIP	23592263
MIRT454974	hsa-miR-302a-5p	PAR-CLIP	23592263
MIRT053756	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT000417	hsa-let-7a-5p	TRAP	24510096
MIRT052217	hsa-let-7b-5p	TRAP	24510096
MIRT003748	hsa-let-7c-5p	TRAP	24510096
MIRT439137	hsa-let-7d-5p	TRAP	24510096
MIRT439135	hsa-let-7e-5p	TRAP	24510096
MIRT032089	hsa-let-7f-5p	TRAP	24510096
MIRT000475	hsa-let-7g-5p	TRAP	24510096
MIRT439133	hsa-let-7i-5p	TRAP	24510096
MIRT439112	hsa-miR-1248	TRAP	24510096
MIRT439110	hsa-miR-125a-3p	TRAP	24510096
MIRT439111	hsa-miR-125a-5p	TRAP	24510096
MIRT105090	hsa-miR-1294	TRAP	24510096
MIRT439108	hsa-miR-148a-5p	TRAP	24510096
MIRT439107	hsa-miR-151a-5p	TRAP	24510096
MIRT439105	hsa-miR-16-5p	TRAP	24510096
MIRT439104	hsa-miR-196a-5p	TRAP	24510096
MIRT439103	hsa-miR-196b-5p	TRAP	24510096
MIRT004307	hsa-miR-21-5p	TRAP	24510096
MIRT439102	hsa-miR-222-3p	TRAP	24510096
MIRT439101	hsa-miR-23a-3p	TRAP	24510096
MIRT438796	hsa-miR-25-3p	TRAP	24510096
MIRT105107	hsa-miR-2682-5p	TRAP	24510096
MIRT439099	hsa-miR-30c-5p	TRAP	24510096
MIRT439097	hsa-miR-30d-5p	TRAP	24510096
MIRT439096	hsa-miR-3159	TRAP	24510096
MIRT054238	hsa-miR-33a-5p	TRAP	24510096
MIRT000695	hsa-miR-34a-5p	TRAP	24510096
MIRT004402	hsa-miR-34c-5p	TRAP	24510096
MIRT439093	hsa-miR-375	TRAP	24510096
MIRT105101	hsa-miR-449a	TRAP	24510096
MIRT007308	hsa-miR-449c-5p	TRAP	24510096
MIRT439092	hsa-miR-4510	TRAP	24510096
MIRT439090	hsa-miR-455-3p	TRAP	24510096
MIRT439091	hsa-miR-4677-3p	TRAP	24510096
MIRT439089	hsa-miR-516a-5p	TRAP	24510096
MIRT439087	hsa-miR-92a-3p	TRAP	24510096
MIRT439088	hsa-miR-92b-3p	TRAP	24510096
MIRT105103	hsa-miR-940	TRAP	24510096
MIRT003438	hsa-miR-98-5p	TRAP	24510096
MIRT000417	hsa-let-7a-5p	TRAP	24510096
MIRT052217	hsa-let-7b-5p	TRAP	24510096
MIRT003748	hsa-let-7c-5p	TRAP	24510096
MIRT439137	hsa-let-7d-5p	TRAP	24510096
MIRT439135	hsa-let-7e-5p	TRAP	24510096
MIRT032089	hsa-let-7f-5p	TRAP	24510096
MIRT000475	hsa-let-7g-5p	TRAP	24510096
MIRT439133	hsa-let-7i-5p	TRAP	24510096
MIRT439112	hsa-miR-1248	TRAP	24510096
MIRT439110	hsa-miR-125a-3p	TRAP	24510096
MIRT439111	hsa-miR-125a-5p	TRAP	24510096
MIRT105090	hsa-miR-1294	TRAP	24510096
MIRT439108	hsa-miR-148a-5p	TRAP	24510096
MIRT439107	hsa-miR-151a-5p	TRAP	24510096
MIRT439105	hsa-miR-16-5p	TRAP	24510096
MIRT439104	hsa-miR-196a-5p	TRAP	24510096
MIRT439103	hsa-miR-196b-5p	TRAP	24510096
MIRT004307	hsa-miR-21-5p	TRAP	24510096
MIRT439102	hsa-miR-222-3p	TRAP	24510096
MIRT439101	hsa-miR-23a-3p	TRAP	24510096
MIRT438796	hsa-miR-25-3p	TRAP	24510096
MIRT105107	hsa-miR-2682-5p	TRAP	24510096
MIRT439099	hsa-miR-30c-5p	TRAP	24510096
MIRT439097	hsa-miR-30d-5p	TRAP	24510096
MIRT439096	hsa-miR-3159	TRAP	24510096
MIRT054238	hsa-miR-33a-5p	TRAP	24510096
MIRT000695	hsa-miR-34a-5p	TRAP	24510096
MIRT004402	hsa-miR-34c-5p	TRAP	24510096
MIRT439093	hsa-miR-375	TRAP	24510096
MIRT105101	hsa-miR-449a	TRAP	24510096
MIRT007308	hsa-miR-449c-5p	TRAP	24510096
MIRT439092	hsa-miR-4510	TRAP	24510096
MIRT439090	hsa-miR-455-3p	TRAP	24510096
MIRT439091	hsa-miR-4677-3p	TRAP	24510096
MIRT439089	hsa-miR-516a-5p	TRAP	24510096
MIRT439087	hsa-miR-92a-3p	TRAP	24510096
MIRT439088	hsa-miR-92b-3p	TRAP	24510096
MIRT105103	hsa-miR-940	TRAP	24510096
MIRT003438	hsa-miR-98-5p	TRAP	24510096
MIRT731172	hsa-miR-130a-3p	Luciferase reporter assay	25544755
MIRT731172	hsa-miR-130a-3p	Luciferase reporter assay	25544755
MIRT731172	hsa-miR-130a-3p	Luciferase reporter assay	25544755
MIRT000695	hsa-miR-34a-5p	qRT-PCR, Western blot	25572695
MIRT004290	hsa-miR-145-5p	Microarray, qRT-PCR, Western blot	26540468
MIRT036232	hsa-miR-320b	Luciferase reporter assay, qRT-PCR, Western blot	26487644
MIRT036232	hsa-miR-320b	Luciferase reporter assay, qRT-PCR, Western blot	26487644
MIRT006820	hsa-miR-33b-5p	Immunohistochemistry, qRT-PCR, Western blot	26729612
MIRT004290	hsa-miR-145-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	26354756
MIRT044759	hsa-miR-320a	Luciferase reporter assay, qRT-PCR, Western blot	28243124
MIRT000121	hsa-miR-24-3p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26159387
MIRT006358	hsa-miR-451a	Luciferase reporter assay, qRT-PCR, Western blot	27571748
MIRT105101	hsa-miR-449a	Luciferase reporter assay, Western blot	27250340
MIRT105101	hsa-miR-449a	Luciferase reporter assay, Western blot	27250340
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105105	hsa-miR-1827	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT499106	hsa-miR-622	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT105112	hsa-miR-8074	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT499108	hsa-miR-889-5p	PAR-CLIP	26701625
MIRT105090	hsa-miR-1294	PAR-CLIP	27292025
MIRT054238	hsa-miR-33a-5p	PAR-CLIP	27292025
MIRT006820	hsa-miR-33b-5p	PAR-CLIP	27292025
MIRT732853	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blotting	33111613
MIRT731172	hsa-miR-130a-3p	Microarray	32046751
MIRT005319	hsa-miR-34b-3p	Western blotting, Microarray, Immunohistochemistry (IHC), qRT-PCR	33300049
MIRT736643	hsa-miR-182-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32867570
MIRT438802	hsa-miR-106b-5p	qRT-PCR	33430425
MIRT224345	hsa-miR-6507-3p	HITS-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	HITS-CLIP	21572407
MIRT105107	hsa-miR-2682-5p	HITS-CLIP	21572407
MIRT004401	hsa-miR-34b-5p	HITS-CLIP	21572407
MIRT007308	hsa-miR-449c-5p	HITS-CLIP	21572407
MIRT499108	hsa-miR-889-5p	HITS-CLIP	21572407
MIRT007105	hsa-miR-135a-5p	HITS-CLIP	21572407
MIRT499107	hsa-miR-135b-5p	HITS-CLIP	21572407
MIRT499106	hsa-miR-622	HITS-CLIP	21572407
MIRT105105	hsa-miR-1827	HITS-CLIP	21572407
MIRT105108	hsa-miR-548au-3p	HITS-CLIP	21572407
MIRT105112	hsa-miR-8074	HITS-CLIP	21572407
MIRT499105	hsa-miR-6765-5p	HITS-CLIP	21572407
MIRT105104	hsa-miR-1304-5p	HITS-CLIP	21572407
MIRT105097	hsa-miR-30a-3p	HITS-CLIP	21572407
MIRT105098	hsa-miR-30d-3p	HITS-CLIP	21572407
MIRT105099	hsa-miR-30e-3p	HITS-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT499108	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT499106	hsa-miR-622	PAR-CLIP	20371350
MIRT105105	hsa-miR-1827	PAR-CLIP	20371350
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT105112	hsa-miR-8074	PAR-CLIP	20371350
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	20371350
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	20371350
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	20371350
MIRT550567	hsa-miR-3133	PAR-CLIP	20371350
MIRT550566	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT105113	hsa-miR-4426	PAR-CLIP	20371350
MIRT105114	hsa-miR-4647	PAR-CLIP	20371350
MIRT105115	hsa-miR-4662b	PAR-CLIP	20371350
MIRT550565	hsa-miR-4762-5p	PAR-CLIP	20371350
MIRT550564	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	20371350
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	20371350
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	20371350
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	20371350
MIRT499108	hsa-miR-889-5p	PAR-CLIP	20371350
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	20371350
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	20371350
MIRT105105	hsa-miR-1827	PAR-CLIP	20371350
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	20371350
MIRT105112	hsa-miR-8074	PAR-CLIP	20371350
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	20371350
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	20371350
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	21572407
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	21572407
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	21572407
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	21572407
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	21572407
MIRT499108	hsa-miR-889-5p	PAR-CLIP	21572407
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	21572407
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	21572407
MIRT499106	hsa-miR-622	PAR-CLIP	21572407
MIRT105105	hsa-miR-1827	PAR-CLIP	21572407
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	21572407
MIRT105112	hsa-miR-8074	PAR-CLIP	21572407
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	21572407
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	21572407
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	21572407
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	21572407
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	21572407
MIRT550567	hsa-miR-3133	PAR-CLIP	21572407
MIRT550566	hsa-miR-186-5p	PAR-CLIP	21572407
MIRT105113	hsa-miR-4426	PAR-CLIP	21572407
MIRT105114	hsa-miR-4647	PAR-CLIP	21572407
MIRT105115	hsa-miR-4662b	PAR-CLIP	21572407
MIRT550565	hsa-miR-4762-5p	PAR-CLIP	21572407
MIRT550564	hsa-miR-4668-5p	PAR-CLIP	21572407
MIRT224345	hsa-miR-6507-3p	PAR-CLIP	24398324
MIRT105100	hsa-miR-323a-3p	PAR-CLIP	24398324
MIRT105107	hsa-miR-2682-5p	PAR-CLIP	24398324
MIRT004401	hsa-miR-34b-5p	PAR-CLIP	24398324
MIRT007308	hsa-miR-449c-5p	PAR-CLIP	24398324
MIRT499108	hsa-miR-889-5p	PAR-CLIP	24398324
MIRT007105	hsa-miR-135a-5p	PAR-CLIP	24398324
MIRT499107	hsa-miR-135b-5p	PAR-CLIP	24398324
MIRT499106	hsa-miR-622	PAR-CLIP	24398324
MIRT105105	hsa-miR-1827	PAR-CLIP	24398324
MIRT105108	hsa-miR-548au-3p	PAR-CLIP	24398324
MIRT105112	hsa-miR-8074	PAR-CLIP	24398324
MIRT499105	hsa-miR-6765-5p	PAR-CLIP	24398324
MIRT105104	hsa-miR-1304-5p	PAR-CLIP	24398324
MIRT105097	hsa-miR-30a-3p	PAR-CLIP	24398324
MIRT105098	hsa-miR-30d-3p	PAR-CLIP	24398324
MIRT105099	hsa-miR-30e-3p	PAR-CLIP	24398324
MIRT105126	hsa-miR-5197-5p	PAR-CLIP	23592263
MIRT454977	hsa-miR-4797-5p	PAR-CLIP	23592263
MIRT454976	hsa-miR-4699-3p	PAR-CLIP	23592263
MIRT105124	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT105125	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT454975	hsa-miR-3919	PAR-CLIP	23592263
MIRT105121	hsa-miR-4289	PAR-CLIP	23592263
MIRT454974	hsa-miR-302a-5p	PAR-CLIP	23592263
MIRT053756	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT755383	hsa-miR-320b	Western blotting, qRT-PCR	38260139
MIRT755557	hsa-miR-3189-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35642054
MIRT1167692	hsa-miR-1178	CLIP-seq
MIRT1167693	hsa-miR-1202	CLIP-seq
MIRT1167694	hsa-miR-1252	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167698	hsa-miR-186	CLIP-seq
MIRT1167699	hsa-miR-200b	CLIP-seq
MIRT1167700	hsa-miR-200c	CLIP-seq
MIRT1167701	hsa-miR-203	CLIP-seq
MIRT1167702	hsa-miR-24	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT1167704	hsa-miR-3154	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167706	hsa-miR-33a	CLIP-seq
MIRT1167707	hsa-miR-33b	CLIP-seq
MIRT1167708	hsa-miR-3664-3p	CLIP-seq
MIRT1167709	hsa-miR-369-3p	CLIP-seq
MIRT1167710	hsa-miR-374a	CLIP-seq
MIRT1167711	hsa-miR-374b	CLIP-seq
MIRT1167712	hsa-miR-376a	CLIP-seq
MIRT1167713	hsa-miR-376b	CLIP-seq
MIRT1167714	hsa-miR-3972	CLIP-seq
MIRT1167715	hsa-miR-4282	CLIP-seq
MIRT1167716	hsa-miR-4284	CLIP-seq
MIRT1167717	hsa-miR-4436a	CLIP-seq
MIRT1167718	hsa-miR-4477a	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167720	hsa-miR-4633-5p	CLIP-seq
MIRT1167721	hsa-miR-4652-3p	CLIP-seq
MIRT1167722	hsa-miR-4776-3p	CLIP-seq
MIRT1167723	hsa-miR-4778-5p	CLIP-seq
MIRT1167724	hsa-miR-491-3p	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167726	hsa-miR-513c	CLIP-seq
MIRT1167727	hsa-miR-548ac	CLIP-seq
MIRT1167728	hsa-miR-548ae	CLIP-seq
MIRT1167729	hsa-miR-548aj	CLIP-seq
MIRT1167730	hsa-miR-548am	CLIP-seq
MIRT1167731	hsa-miR-548d-3p	CLIP-seq
MIRT1167732	hsa-miR-548x	CLIP-seq
MIRT1167733	hsa-miR-548z	CLIP-seq
MIRT1167734	hsa-miR-561	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167692	hsa-miR-1178	CLIP-seq
MIRT1167693	hsa-miR-1202	CLIP-seq
MIRT1167694	hsa-miR-1252	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167701	hsa-miR-203	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT1167704	hsa-miR-3154	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167706	hsa-miR-33a	CLIP-seq
MIRT1167707	hsa-miR-33b	CLIP-seq
MIRT1167708	hsa-miR-3664-3p	CLIP-seq
MIRT1167712	hsa-miR-376a	CLIP-seq
MIRT1167713	hsa-miR-376b	CLIP-seq
MIRT1167714	hsa-miR-3972	CLIP-seq
MIRT2048397	hsa-miR-4263	CLIP-seq
MIRT1167717	hsa-miR-4436a	CLIP-seq
MIRT1167718	hsa-miR-4477a	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167720	hsa-miR-4633-5p	CLIP-seq
MIRT1167721	hsa-miR-4652-3p	CLIP-seq
MIRT1167722	hsa-miR-4776-3p	CLIP-seq
MIRT1167723	hsa-miR-4778-5p	CLIP-seq
MIRT2048398	hsa-miR-4799-5p	CLIP-seq
MIRT1167724	hsa-miR-491-3p	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167726	hsa-miR-513c	CLIP-seq
MIRT1167727	hsa-miR-548ac	CLIP-seq
MIRT1167728	hsa-miR-548ae	CLIP-seq
MIRT1167729	hsa-miR-548aj	CLIP-seq
MIRT1167730	hsa-miR-548am	CLIP-seq
MIRT1167731	hsa-miR-548d-3p	CLIP-seq
MIRT1167732	hsa-miR-548x	CLIP-seq
MIRT1167733	hsa-miR-548z	CLIP-seq
MIRT2048399	hsa-miR-576-5p	CLIP-seq
MIRT1167692	hsa-miR-1178	CLIP-seq
MIRT1167693	hsa-miR-1202	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167699	hsa-miR-200b	CLIP-seq
MIRT1167700	hsa-miR-200c	CLIP-seq
MIRT1167701	hsa-miR-203	CLIP-seq
MIRT1167702	hsa-miR-24	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT2277220	hsa-miR-296-3p	CLIP-seq
MIRT1167704	hsa-miR-3154	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167706	hsa-miR-33a	CLIP-seq
MIRT1167707	hsa-miR-33b	CLIP-seq
MIRT1167708	hsa-miR-3664-3p	CLIP-seq
MIRT1167712	hsa-miR-376a	CLIP-seq
MIRT1167713	hsa-miR-376b	CLIP-seq
MIRT1167714	hsa-miR-3972	CLIP-seq
MIRT1167716	hsa-miR-4284	CLIP-seq
MIRT1167717	hsa-miR-4436a	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167720	hsa-miR-4633-5p	CLIP-seq
MIRT1167721	hsa-miR-4652-3p	CLIP-seq
MIRT1167722	hsa-miR-4776-3p	CLIP-seq
MIRT1167723	hsa-miR-4778-5p	CLIP-seq
MIRT1167724	hsa-miR-491-3p	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167726	hsa-miR-513c	CLIP-seq
MIRT2277221	hsa-miR-629	CLIP-seq
MIRT1167692	hsa-miR-1178	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167706	hsa-miR-33a	CLIP-seq
MIRT1167707	hsa-miR-33b	CLIP-seq
MIRT1167708	hsa-miR-3664-3p	CLIP-seq
MIRT1167712	hsa-miR-376a	CLIP-seq
MIRT1167713	hsa-miR-376b	CLIP-seq
MIRT1167717	hsa-miR-4436a	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167720	hsa-miR-4633-5p	CLIP-seq
MIRT1167724	hsa-miR-491-3p	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167726	hsa-miR-513c	CLIP-seq
MIRT1167701	hsa-miR-203	CLIP-seq
MIRT1167718	hsa-miR-4477a	CLIP-seq
MIRT1167723	hsa-miR-4778-5p	CLIP-seq
MIRT1167734	hsa-miR-561	CLIP-seq
MIRT1167695	hsa-miR-1304	CLIP-seq
MIRT1167696	hsa-miR-135a	CLIP-seq
MIRT1167697	hsa-miR-135b	CLIP-seq
MIRT1167703	hsa-miR-2682	CLIP-seq
MIRT1167705	hsa-miR-323-3p	CLIP-seq
MIRT1167706	hsa-miR-33a	CLIP-seq
MIRT1167707	hsa-miR-33b	CLIP-seq
MIRT1167719	hsa-miR-449c	CLIP-seq
MIRT1167720	hsa-miR-4633-5p	CLIP-seq
MIRT1167724	hsa-miR-491-3p	CLIP-seq
MIRT1167725	hsa-miR-494	CLIP-seq
MIRT1167726	hsa-miR-513c	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AATF	Activation	20549547
AHR	Unknown	11114727;16091746
APC	Repression	16510874
AR	Unknown	24512546
BCL6	Activation	21394099
BDP1	Unknown	12734418
BIN1	Unknown	9797456
BRCA1	Unknown	12032322;12646176
CEBPA	Repression	12032779
CEBPE	Repression	12947005
CHD8	Unknown	16949368
CNBP	Unknown	23774591
CTCF	Activation	19568426
CTCF	Repression	12032779;12524457
CTCF	Unknown	24725430;9591631
CTNNB1	Activation	20300972;21533051
CTNNB1	Unknown	17724465;18679417;19662654;19778454
DLX5	Activation	19497851
E2F1	Activation	11705881
E2F4	Unknown	17132729
E2F5	Unknown	17132729
ENO1	Repression	10681589;9119380
ENO1	Unknown	10528225;10802057;18490439;20412594;7880838
EP300	Repression	19279113
ESR1	Unknown	11517191;19569049;22892083
ETS2	Unknown	22108824
EZH2	Repression	23079660
FOS	Repression	2498162
FOXA1	Unknown	24512546
FOXM1	Activation	23804320
FUBP1	Unknown	11239393;18193062;24117486
HDAC11	Unknown	20493879
HDAC2	Unknown	20493879
HDAC3	Repression	19279113;23079660;23714368
HIC1	Repression	24067369
HNF4A	Activation	23714368
HOXA1	Activation	15665309
IFI16	Repression	20052289
JUN	Repression	2498162
L3MBTL1	Unknown	23543057
LEF1	Unknown	19620402
MAX	Unknown	9797456
MTA1	Unknown	12431981
MXI1	Repression	8838813
MYB	Activation	1594249
MYB	Unknown	11259163;16088151;19609274
MYBL2	Activation	1594249
NF1	Activation	9562250
NFKB1	Activation	17018379
NFKB1	Repression	18566231
NFKB1	Unknown	11114727;12894581;17673602;17944672;18184402;19469019;19766095;21790895
PGR	Unknown	22892083
PPARG	Repression	11973610
PRDM1	Repression	10713181;12032779
PTTG1	Activation	22475756
PTTG1	Unknown	11115508
RB1	Repression	10200487;9671466
RB1	Unknown	7680889
RBL1	Unknown	17132729;9797456
RELA	Activation	17018379
RELA	Repression	18566231
RELA	Unknown	11114727;12894581;17673602;17944672;18184402;19469019;19766095;21790895
RFX1	Repression	10918054;12032779
RUNX3	Repression	20442291
SIRT1	Repression	22245592;22483777
SMAD3	Unknown	17132729
SMAD4	Unknown	17132729
SMAD7	Activation	15555279
SNIP1	Unknown	17157259
SP1	Unknown	2057364;8355712
SRSF1	Unknown	22545246
STAT3	Activation	15184887;17204573;19259613
STAT3	Repression	20067773;22317895
STAT3	Unknown	10464281;15469392;18184402;20654581
STAT4	Activation	10702306
TBL1X	Unknown	20493879
TBP	Unknown	7880838;9797456
TCF3	Activation	22384858
TCF3	Repression	21788410
TCF4	Activation	21533051
TCF4	Unknown	15928669;19561604;19662654;19778454
TLX1	Activation	20618946
TP53	Repression	19411072
TP53	Unknown	19202062
WDR5	Unknown	24782528
WT1	Repression	17634147
WT1	Unknown	15286719
YY1	Activation	18490439
YY1	Repression	19279113
YY1	Unknown	10528225;17434929;9797456
ZBTB7A	Repression	17189472
ZNF300	Activation	21777376
ZNF382	Repression	20682794

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	25438055
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	9924025, 10412034, 18393360, 19160485
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	19786833
GO:0000165	Process	MAPK cascade	IMP	17873522
GO:0000785	Component	Chromatin	IDA	30158517
GO:0000785	Component	Chromatin	IMP	12837246
GO:0000785	Component	Chromatin	ISA
GO:0000791	Component	Euchromatin	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	10723141
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	19786833
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	9924025, 10723141
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	25956029
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0001046	Function	Core promoter sequence-specific DNA binding	IDA	30873824
GO:0001221	Function	Transcription coregulator binding	IPI	15674325
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	29203640
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IMP	19786833
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	10723141, 27791094
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	ISS
GO:0001783	Process	B cell apoptotic process	IEA
GO:0001866	Process	NK T cell proliferation	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	ISS
GO:0002904	Process	Positive regulation of B cell apoptotic process	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003677	Function	DNA binding	TAS	10597290
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	8755740, 9184233, 9308237, 9708738, 10597290, 11891322, 12706874, 15103331, 15663936, 15992821, 16352593, 16606833, 16996503, 17070091, 17157259, 17314511, 17418410, 17599065, 17632056, 17873522, 18256156, 18393360, 18413597, 18620061, 18923429, 19131971, 19786833, 20195357, 2020851
GO:0005634	Component	Nucleus	IDA	8782822, 11793365, 15358760, 15994933, 18393360
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	8425218
GO:0005634	Component	Nucleus	TAS	9187264
GO:0005654	Component	Nucleoplasm	IDA	17558397
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	17558397, 25775507, 38225354
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0006338	Process	Chromatin remodeling	IDA	21533051
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IDA	9924025
GO:0006974	Process	DNA damage response	IDA	17873522
GO:0006974	Process	DNA damage response	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15994933
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0009314	Process	Response to radiation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEP	18291362
GO:0010468	Process	Regulation of gene expression	IDA	21447833
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010564	Process	Regulation of cell cycle process	IDA	8782822
GO:0010628	Process	Positive regulation of gene expression	IDA	15459207
GO:0010628	Process	Positive regulation of gene expression	IGI	15459207
GO:0014902	Process	Myotube differentiation	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016072	Process	RRNA metabolic process	IMP	38225354
GO:0016485	Process	Protein processing	IEA
GO:0016604	Component	Nuclear body	IEA
GO:0030424	Component	Axon	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0032204	Process	Regulation of telomere maintenance	IMP	17765874
GO:0032206	Process	Positive regulation of telomere maintenance	IEA
GO:0032206	Process	Positive regulation of telomere maintenance	ISS
GO:0032873	Process	Negative regulation of stress-activated MAPK cascade	ISS
GO:0032986	Process	Protein-DNA complex disassembly	IDA	19160485
GO:0032991	Component	Protein-containing complex	IDA	17873522, 19160485
GO:0034644	Process	Cellular response to UV	IEP	17873522
GO:0035457	Process	Cellular response to interferon-alpha	IEA
GO:0035914	Process	Skeletal muscle cell differentiation	IEA
GO:0042474	Process	Middle ear morphogenesis	IEA
GO:0042802	Function	Identical protein binding	IPI	9184233, 25609649
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	29203640
GO:0043279	Process	Response to alkaloid	IEA
GO:0043473	Process	Pigmentation	IEA
GO:0044027	Process	Negative regulation of gene expression via chromosomal CpG island methylation	IMP	19786833
GO:0044346	Process	Fibroblast apoptotic process	TAS	10962037
GO:0044877	Function	Protein-containing complex binding	IDA	18987311
GO:0045656	Process	Negative regulation of monocyte differentiation	IMP	9924025
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	8425218, 10962037, 17558397, 18818310
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12676957, 17884155
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10723141
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	9924025
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	9924025, 18987311
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	15674325
GO:0048147	Process	Negative regulation of fibroblast proliferation	IDA	10962037
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	18987311
GO:0050910	Process	Detection of mechanical stimulus involved in sensory perception of sound	IEA
GO:0051276	Process	Chromosome organization	IDA	10962037
GO:0051782	Process	Negative regulation of cell division	IDA	10962037
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IEA
GO:0060633	Process	Negative regulation of transcription initiation by RNA polymerase II	IDA	29203640
GO:0070371	Process	ERK1 and ERK2 cascade	IDA	15459207
GO:0070848	Process	Response to growth factor	TAS	18987311
GO:0070888	Function	E-box binding	IDA	18818310, 27791094
GO:0071456	Process	Cellular response to hypoxia	IDA	15459207
GO:0071466	Process	Cellular response to xenobiotic stimulus	IDA	17873522
GO:0071943	Component	Myc-Max complex	IEA
GO:0071943	Component	Myc-Max complex	IPI	12553908
GO:0090096	Process	Positive regulation of metanephric cap mesenchymal cell proliferation	IEA
GO:0090096	Process	Positive regulation of metanephric cap mesenchymal cell proliferation	ISS
GO:0090571	Component	RNA polymerase II transcription repressor complex	IPI	15992821, 18393360
GO:0140297	Function	DNA-binding transcription factor binding	IPI	15674325, 19160485
GO:1902255	Process	Positive regulation of intrinsic apoptotic signaling pathway by p53 class mediator	IDA	10962037
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	27791094
GO:1904672	Process	Regulation of somatic stem cell population maintenance	IEA
GO:1904672	Process	Regulation of somatic stem cell population maintenance	ISS
GO:1904699	Process	Positive regulation of acinar cell proliferation	IEA
GO:1905761	Function	SCF ubiquitin ligase complex binding	IPI	12769844, 15103331, 15150404
GO:1990863	Process	Acinar cell proliferation	IEA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 190080
• HGNC: 7553
• e!Ensembl: ENSG00000136997

Protein

• UniProt ID: P01106
• Protein name: Myc proto-oncogene protein (Class E basic helix-loop-helix protein 39) (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64)
• Protein function: Transcription factor that binds DNA in a non-specific manner, yet also specifically recognizes the core sequence 5'-CAC[GA]TG-3' (PubMed:24940000, PubMed:25956029). Activates the transcription of growth-related genes (PubMed:24940000, PubMed:259
• PDB: 1A93, 1EE4, 1MV0, 1NKP, 2A93, 2OR9, 4Y7R, 5I4Z, 5I50, 6C4U, 6E16, 6E24, 6G6J, 6G6K, 6G6L, 7T1Y, 7T1Z, 8J2Q, 8OTS, 8OTT, 8Q1N, 8WLG, 8X8S, 8X8V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01056	Myc_N	1 → 345	Myc amino-terminal region	Family
  PF00010	HLH	355 → 407	Helix-loop-helix DNA-binding domain	Domain
  PF02344	Myc-LZ	408 → 438	Myc leucine zipper domain	Coiled-coil

• Sequence:

  MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
  LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
  DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
  LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
  HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
  HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
  VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
  RKRREQLKHKLEQLRNSCA

• Sequence length: 439

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Acute myeloid leukemia	Pathogenic	rs750664148	RCV003883217	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Burkitt lymphoma	Pathogenic	rs28933407, rs121918683, rs121918684	RCV000013402 RCV000013403 RCV000013404	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, DUCTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, MERKEL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholesteatoma of middle ear	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Classic Hodgkin lymphoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT LIP	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT PALATE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEFT UPPER LIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLETE UNILATERAL CLEFT LIP	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMYELINATING DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMANGIOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYC-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYELODYSPLASTIC SYNDROMES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	other	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC KIDNEY DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC KIDNEY, AUTOSOMAL DOMINANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian failure	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	1575012		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	19673870		★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	11843291		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	16856965, 25784651, 25800664, 27810071, 3165487, 8324225, 8632682		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12580957, 14576768, 18005389, 22563559, 22911553, 23673335, 23997116, 24686171, 24829203, 25194570, 26857438, 27095570, 27987331, 29022749, 29407586, 30930624, 30985716, 3106693, 31247466, 7596184, 7691153, 8142255		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	3165487		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	25956709		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	BEFREE	18656691		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	25956709		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	12550765, 16631470, 19324018, 19408305, 20113841, 21059853, 24095829, 2444981, 26545364, 27486764, 3325877, 6298632, 8012982		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11175856, 11392879, 12851682, 14581353, 15493579, 1552612, 1586594, 16309200, 16886612, 17431415, 18262050, 20059402, 20232185, 21685943, 22585994, 24809777, 24858378, 2547415, 26554830, 28899736, 28933766, 29788391, 3283655		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12209953, 16984727, 17587243, 18559552, 18932273		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15493579, 1773788, 3342413		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	12524396, 18493233, 23925667, 30353671		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	31239274		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18461184, 21148746, 21151896, 21406400, 22045881, 22914773, 23239811, 24793789, 24809777, 26483346, 26656844, 26833129, 29805633		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	26656844, 27602772		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	28414305, 28888037		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	BEFREE	20565940, 23866769		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	28594149		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	20196079, 21102417, 21406400, 27245242, 2842040		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	11751426, 30460421		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10523691, 18444242, 18593890, 19609274, 27595705, 2826545, 2842040, 30620391, 31441682		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	30412224		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	9071974		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	21685915, 22706201, 2405002, 26070438, 9071974, 9177412		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35279598	Associate	★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	29065337	Associate	★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	23997116, 24686171, 24829203, 26517351, 26857438, 27095570, 27987331, 29022749, 30930624, 3106693, 31247466, 7596184		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	11182042, 11697627, 15258997, 17175379, 18024371, 18752503, 19038003, 19151788, 19278952, 19638549, 19704118, 20118770, 20348878, 20378577, 20498406, 21266718, 21692100, 22314191, 22851565, 23313364, 23335369, 23355209, 23363269, 23449635, 23673335, 23716551, 23795946, 23892979, 23922484, 24040459, 24336156, 24506200, 24619762, 24674866, 24719189, 24740248, 25090026, 25284491, 25677902, 25696841, 25741152, 25827211, 25828389, 26158410, 26340843, 26421520, 26541272, 26573234, 26820684, 26927665, 27027803, 27071312, 27093450, 27125356, 27282353, 27469075, 27633159, 27708232, 28209136, 28212447, 28291124, 28327893, 28595732, 28639315, 28643426, 28686226, 28776574, 28838257, 28985492, 29037890, 29250662, 29666157, 29674626, 30501868, 30573511, 30953469, 31028445, 31050117, 31243099, 31259656, 31315646, 31399522, 31644584, 9787151		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	16614247, 26988986, 28432871		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	10643003, 11008200, 11489822, 11958658, 12175339, 12910530, 12941792, 1374522, 16423996, 17102621, 17465989, 18317693, 19119907, 19134217, 19584924, 20607354, 21129063, 21317922, 21324178, 21793975, 2180567, 22016811, 22139329, 22160402, 22340591, 22402744, 23578955, 23852775, 24186490, 24196163, 24231268, 24297863, 24708907, 24796395, 25533335, 25576913, 25739120, 27012813, 27040285, 27255663, 27775567, 27966820, 28159923, 28409891, 28504719, 29280516, 29511348, 29562177, 29682173, 29721192, 29880921, 30392813, 30445362, 30611741, 30626740, 30632221, 30725256, 30901604, 30918335, 31160565, 31340195, 31382461, 31694585, 8529284, 9482408		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	1587003, 17483057, 2189107, 28498285		★☆☆☆☆ Found in Text Mining only
African Burkitt`s lymphoma	African Burkitt`s Lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	29721608		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	2323837		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26059363, 29753274, 31401456, 31698192	Associate	★☆☆☆☆ Found in Text Mining only
Amaurosis congenita of Leber type 1	Leber congenital amaurosis	Pubtator	37014508	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	11302243		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22673189		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	26075709, 34662711	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	10797498, 16423996, 19134217, 25655563, 29523784, 31356991		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	LHGDN	15198123, 16423996		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	Pubtator	17254356, 19134217	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	2228319		★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	BEFREE	16955462, 29609590		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	28368473, 30015867, 30400007, 30459933, 31272080, 31601917		★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	26354756	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	2179128	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	17036397, 34131801	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	21102417, 2538323	Stimulate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	23825360	Associate	★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	16364759		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24807963, 26119937, 26676757, 27406986, 28369619, 28947981, 30228208, 30378060, 30423298, 31311847, 31396352, 31649109		★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	39358545	Associate	★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus neoplasm	Pubtator	7679417	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	28076932	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27689328		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	29721608		★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	Pubtator	39252332	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	26387865	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11286645, 30864721, 8350425		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	10982649		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10323451	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15589822, 35886000	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27188427, 31833571		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	11381677, 19143767, 20068183, 22805177, 23934175, 29523126, 36260562	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12127399, 18369647, 27600094		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	18369647		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	30400007, 9614908		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	39940843	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11286645, 30864721, 8350425		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33747117	Associate	★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	20113841		★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	19725831, 27966820, 30010851		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34438162	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	2179128, 27630164, 34857874	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	11163079, 11566339, 12670331, 12808455, 12810261, 15095297, 15258997, 15477387, 15642390, 15716988, 15940261, 16094360, 16258503, 17230227, 17639584, 18024324, 18510704, 18981293, 19596258, 19597184, 19755676, 20118770, 20303018, 20348878, 20442643, 20660329, 21319257, 21490439, 21606168, 21646687, 22002575, 22002677, 22014048, 22018272, 22194861, 22510149, 22754359, 22974238, 23012230, 23079660, 23098454, 23143595, 23171357, 23178486, 23330001, 23331925, 23348205, 23355209, 23403624, 23538750, 23599149, 23619105, 23795946, 23939148, 23959583, 24009228, 24118498, 24222112, 24319234, 24394940, 24397618, 24398325, 24614699, 24679006, 24733537, 24761809, 24943107, 2503246, 25060305, 25103070, 25125624, 25199984, 25258344, 2535034, 25468432, 25581730, 25656914, 25696840, 25696841, 25807917, 25828391, 25915584, 25915824, 25916698, 25953460, 26224092, 26295308, 26300063, 26307073, 26390147, 26416427, 26426741, 2642893, 26464726, 26517511, 26558423, 26565895, 26573234, 26727417, 26832406, 26834124, 26887776, 26916070, 27027803, 27239040, 27282353, 27469075, 27521276, 27806850, 27821509, 28094768, 28288039, 28368423, 28379189, 28562582, 28595585, 28614202, 28844114, 28868942, 28881619, 28984304, 29071477, 29327714, 29328384, 29581544, 29629947, 29769234, 29785017, 29902576, 30033208, 30038718, 30104685, 30135222, 30172916, 30252929, 30260324, 30277098, 30371509, 30448222, 30496802, 30501868, 30675232, 30707764, 30737994, 30864721, 30874346, 30953469, 31171817, 31187528, 31229156, 31350178, 31408531, 31527075, 31683676, 31748534, 31822509, 3186743, 3261863, 3491176, 3540591, 6298632, 8062825, 8684002, 9224748, 9402172, 9546285		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	12562237, 15191563, 16690525, 18024371, 18066065, 18426731, 18752503		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	2069907		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	12524396, 18493233, 26104750, 29991802		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	12524396, 26297437	Stimulate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	18559552, 18953412		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	18953412, 26104750, 26926447	Associate	★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	3494689		★☆☆☆☆ Found in Text Mining only
Benign Meningioma	Benign Meningioma	BEFREE	11311470, 18808065		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	11311470, 8262479		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	11559025		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	14997205, 24568597		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10096250, 11848469, 19369583, 19801959, 22711262, 24155119, 26600535, 26939702, 27456363, 29423038, 29463565, 30819803, 30866868, 30968727, 31190871, 31761897, 7609100, 7747807, 9612689		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12394763, 15986448		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	2228319		★☆☆☆☆ Found in Text Mining only
Blast Crisis	Blast crisis	Pubtator	18534064, 32517078	Associate	★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	16685411, 17284533, 26179066		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	1645226, 2687770, 8545108		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	16497877, 22330139, 31391404	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	12745652	Stimulate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	2070052, 32273477	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	33417873	Associate	★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	35141331	Associate	★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	28339425	Inhibit	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	1317500, 22068108, 22348395, 27852622, 28729418, 3001737		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	18059365, 27852622, 29117471, 3001737, 33430425, 37147437, 37423059	Associate	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	15929079		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10383126, 10567899, 10639563, 10652430, 10741284, 11104567, 11738392, 11786932, 12007633, 12036924, 12950019, 14729606, 14760071, 15083194, 15286719, 15656577, 15743499, 15757889, 16331604, 16423995, 16497871, 16527609, 17052904, 17066426, 17158641, 17908964, 18199546, 18245497, 18348306, 18373870, 18497068, 18925859, 18996220, 19242061, 19270750, 1961733, 19740597, 20139910, 20144848, 20886042, 21226903, 21346144, 21575199, 21646475, 21808024, 21909081, 21986497, 22056952, 22581054, 22612343, 22863309, 23145106, 23393560, 23555992, 23649631, 23776131, 23813010, 23965903, 24190141, 24316975, 24444383, 24927563, 25270118, 25363551, 25531321, 25636967, 25683269, 25716159, 26180042, 26452386, 26490253, 2668848, 26735859, 26758430, 26822264, 2686529, 26950360, 26954716, 2707103, 27208794, 27283966, 27775705, 27795300, 27811364, 27852327, 27899639, 27960236, 28089283, 28160502, 28186965, 28215225, 2838785, 28464854, 28490334, 28696357, 28709002, 28716678, 28870680, 29181861, 29185119, 29212204, 29243807, 29480818, 29545595, 29622465, 30018709, 3014513, 30149665, 30248461, 30266755, 30324719, 30420657, 30524945, 30526553, 3060796, 30688660, 30703514, 30728358, 30746633, 30843188, 30885118, 31144531, 31326549, 31570853, 31577739, 31763993, 31775037, 7607564, 7910618, 7913873, 8100712, 8124858, 8432027, 8455947, 8814449, 8993975, 9164674, 9187125, 9237184		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	8455947		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10604737, 11158583, 11304576, 11706062, 12032322, 12379776, 1309531, 14997205, 15083194, 15743499, 15757889, 15803183, 15808510, 16107734, 16497871, 16518402, 1683873, 16996503, 17158641, 17159920, 17534450, 17567920, 17572360, 17998543, 18167534, 18348306, 18373870, 18474089, 1849359, 18586674, 18642118, 18816594, 18818310, 1922031, 19242061, 19638211, 19675743, 19690609, 19706770, 19865540, 20008325, 20133671, 20139903, 20139910, 20169162, 20453196, 20473280, 20716114, 20920219, 21050467, 21245420, 21346144, 21505052, 21575199, 21614210, 21646475, 21668996, 21835891, 21899728, 21909081, 22056952, 22152285, 22190494, 22371483, 22666420, 22815474, 22863309, 22937096, 22941468, 23098454, 23145106, 23161755, 23266555, 23368093, 23393560, 23468463, 23530127, 23555992, 23776131, 23860775, 23914993, 23986566, 24147022, 24309997, 24316975, 24444383, 24621502, 24927563, 24931809, 25186909, 25374215, 25531321, 25663530, 25683269, 2572268, 25895136, 26008969, 26099045, 26617750, 26735859, 26758430, 26915294, 26954716, 27028851, 27184134, 27197167, 27208794, 27283966, 27512948, 27725455, 27795300, 27811364, 28192473, 28399911, 28423718, 28464854, 28817737, 28914785, 29108569, 29125598, 29169183, 29181861, 29202474, 29280996, 29328377, 29523126, 29545595, 29619374, 29789342, 29880857, 30119151, 3014513, 30248461, 30305424, 30419347, 30420657, 30448314, 3045126, 30501643, 30575917, 30710426, 30746633, 30776175, 30777332, 30885118, 30989585, 31072371, 31144531, 31350286, 31577739, 31690832, 31801599, 31839604, 31874204, 31907353, 31942031, 32319562, 32626933, 32746451, 3290209, 32934206, 33006750, 33082214, 33143224, 33191115, 33293374, 33307492, 33340428, 33390842, 33391729, 33469161, 33626175, 33854152, 34349094, 34493366, 34551213, 34572047, 34693792, 34884765, 35177782, 35179222, 35180770, 35217381, 35217791, 35361013, 35381768, 35382692, 35563554, 35639264, 35692593, 36289203, 36305094, 36368728, 36404592, 36417849, 36484686, 36725888, 36770598, 36782197, 36982338, 37068562, 37145128, 37340461, 37353799, 37556419, 37570631, 37685841, 37804426, 37890492, 37973687, 37987734, 38048842, 38101533, 38186581, 39174945, 39366987, 39550832, 40114244, 40311680, 40595045, 40710353, 40711670, 7567474, 7794075, 7880720, 7903963, 8104920, 8497271, 8529465, 9310246, 9804832	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12817989, 23704974	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	40362536	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	11449307, 20152033, 22527098	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	BEFREE	15973450, 16772123, 18005389, 2406517, 24668946, 26449660, 26489677, 31705772, 9402334		★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	10022853, 10550304, 10556095, 10618400, 10706881, 10828444, 10866684, 10997962, 11072243, 11777933, 11917131, 12515726, 12553908, 12594230, 12670331, 12719541, 12808131, 1317726, 14508797, 1472633, 15098014, 15692060, 15840698, 15986398, 16258503, 16515618, 16543692, 16675879, 1671647, 16736499, 16760443, 16848772, 16955460, 17001014, 17485552, 17785433, 18271922, 18477041, 1849033, 18612102, 18628086, 19019773, 19020548, 19022773, 19144381, 19283066, 1932754, 19363496, 19406837, 19763338, 19810101, 19895612, 20118770, 20348878, 2052620, 20614267, 20737197, 20823132, 20823134, 20930934, 2110009, 21701491, 21831295, 21931777, 21981616, 22002311, 22102868, 22225880, 22241218, 22374697, 22389885, 22511926, 22615405, 22661084, 22726497, 22779071, 22885699, 22967991, 23091298, 23143597, 23179058, 23237561, 23276184, 23355209, 23607450, 23673335, 23891576, 23966164, 2407738, 24179151, 24398325, 24466310, 24675470, 2470097, 25099163, 25258344, 25468432, 2548209, 2551669, 25595783, 25621564, 25673455, 25677902, 26051217, 26104998, 26218299, 26312753, 26317903, 26325594, 26351698, 26437030, 26453442, 26468873, 26763367, 26873538, 26916070, 2710118, 27282353, 27352258, 27390358, 2747644, 2820714, 2833750, 2840989, 28801451, 29078819, 29112016, 29272887, 29313490, 29318382, 29327714, 29476010, 2998760, 3004968, 3018508, 3032447, 3033665, 3035497, 30567752, 30779244, 30926794, 30953469, 31083180, 3110600, 3128772, 31399522, 31520998, 3162550, 31719683, 31738823, 31748534, 31888714, 31955214, 32017050, 32127902, 32180880, 32239695, 32391636, 32449435, 33020271, 33528622, 33879463, 33994432, 34059753, 34472720, 34500469, 34534532, 3458257, 3464006, 34668039, 35135797, 35205272, 35503749, 35563017, 36012375, 36719239, 36792656, 36849510, 3691477, 37053555, 37436268, 37926284, 38035700, 38057307, 3856876, 3887132, 3921823, 3923436, 39375391, 40085439, 40572059, 4092694, 6095051, 6328505, 6330529, 6402776, 6441706, 6585808, 6593728, 6961453, 7485402, 7718888, 7768941, 7836923, 7969136, 8355712, 8366102, 8376401, 8392399, 8404859, 8408711, 8617212, 8621409, 8704258, 8816814, 8979089, 9160681, 9192778, 9332331, 9402172, 9446660, 9482908, 9689053	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	10208435, 10550304, 10653866, 10657901, 10760826, 10825194, 10866684, 10918597, 10931834, 11024153, 11034608, 11360201, 11587216, 11714983, 11777933, 11793449, 11795942, 12002338, 12055673, 12507816, 12719541, 12769686, 1325169, 1339415, 1384683, 14697225, 14712292, 15034863, 15098014, 15257933, 15287031, 15381365, 1563831, 15642390, 15735016, 15840698, 15973450, 16006805, 16094360, 16146820, 1620543, 16258503, 16515618, 16675879, 16772123, 16856965, 1713514, 17211884, 17230227, 17503467, 17541401, 1782076, 17942906, 18024324, 18037408, 18042696, 18314482, 1849033, 18716017, 18802929, 18923440, 1899807, 19008891, 19144381, 19165855, 19530237, 19597184, 19670467, 19844983, 19895612, 20118770, 20160479, 20193852, 20346013, 20348878, 20442643, 20661666, 2069907, 20737197, 20817505, 20823134, 20930934, 21119107, 21239197, 21383964, 21412927, 21478429, 21490439, 21560252, 21740296, 21913186, 2196779, 22002677, 22018272, 22039254, 22102868, 22120970, 22314191, 22374697, 22691117, 22726497, 22885699, 22897848, 22915650, 22967991, 2298494, 23012230, 23143595, 23171357, 23225516, 23313364, 23341364, 23348205, 23355209, 23525267, 23673335, 23795946, 23939148, 24009228, 24222112, 24319234, 24397618, 24398325, 24466310, 24492847, 24614699, 24668946, 24679006, 2470097, 24713985, 24867287, 24998853, 25199984, 25258344, 25403088, 25468432, 2548209, 2551670, 25581730, 25611295, 25677902, 25696841, 26173642, 26182827, 26218299, 26312753, 26416427, 26437030, 26453442, 26643319, 26785246, 2682665, 26887776, 26916070, 27044389, 2710118, 27125356, 27257042, 27282353, 27590350, 27810071, 28288039, 2840989, 28515100, 28521631, 28562582, 28603988, 28619753, 28648593, 28801451, 28976731, 29100357, 29112016, 29132323, 2914707, 29272887, 29318382, 29327714, 29463831, 3004968, 30104685, 3011242, 30237309, 3033665, 3039510, 30423267, 30453475, 30569626, 30701532, 30779244, 30914792, 30953469, 31000522, 31039827, 3110600, 31173259, 3128772, 31645904, 31705772, 31719683, 31738823, 31748534, 31767764, 31844144, 3458257, 3458667, 3466870, 3691477, 3856876, 3921823, 6188153, 6306472, 6327023, 6327064, 6327071, 6402776, 6414718, 6419122, 6419124, 6441706, 6547209, 6593728, 6646201, 6818551, 7519050, 7691153, 7923569, 7969121, 7969136, 8012955, 8182948, 8280621, 8376401, 8397370, 8404859, 8416737, 8444346, 8502472, 8528061, 8562172, 8621409, 8946941, 9187426, 9192778, 9192833, 9322889, 9332331, 9378470, 9433379, 9643977, 9839505		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Burkitt Lymphoma	Burkitt`s Lymphoma	LHGDN	11443860, 12808131, 14697225, 16169462, 16466700, 16675879, 17001014, 17541401		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	29132323, 31560931	Stimulate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Burkitt Lymphoma	Burkitt`s Lymphoma	ORPHANET_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Burkitt Lymphoma	Burkitt`s Lymphoma	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Burkitt Lymphoma	Burkitt`s Lymphoma	UNIPROT_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Burkitt Lymphoma	Burkitt`s Lymphoma	CGI_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Burkitt Lymphoma	Burkitt`s Lymphoma	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Burkitt lymphoma	Burkitt`s Lymphoma	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cap Myopathy	Cap myopathy	Pubtator	16827116	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10036781, 11115508, 11865060, 12378623, 12657136, 12842909, 15199147, 15382088, 15493579, 15528212, 15644444, 1569190, 15810077, 16280331, 16474375, 16609989, 16610058, 16984727, 17093053, 17157259, 17171786, 17549669, 17567920, 18190704, 18816594, 19596917, 20848231, 21297663, 21329882, 21556123, 21646475, 22371483, 23308051, 23594796, 23717612, 23906881, 24053468, 24668547, 2470097, 24740298, 2502519, 25185650, 25569455, 25632068, 26046465, 2631744, 26950360, 27323397, 27341130, 27366943, 27402308, 27748763, 27919448, 28463531, 28691902, 28846112, 28924385, 28974238, 29267898, 29546066, 29690860, 29880857, 30139745, 30229897, 3043196, 30770877, 31570856, 31703161, 32059763, 32102509, 32127525, 32188705, 33078202, 33208877, 33335067, 33430425, 33754045, 33860275, 34628367, 34723715, 34824301, 35210568, 35247260, 35438040, 35509706, 35705031, 36631756, 37517480, 37612308, 38223598, 6089208, 6300869, 9626044	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20123981	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	24586304, 25921139, 32732221, 33351778, 36433941, 37148657	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11817538, 11911252, 12853350, 1444241, 14997205, 1649348, 17070983, 17158641, 1741403, 1850659, 19084934, 21406400, 22999547, 24337011, 25139102, 25200035, 2569035, 27197165, 29523126, 29525942, 29790697, 31442917, 7913084, 8014012, 8414499, 8453595, 8993975, 9135021, 9286730, 9369962, 9612689, 9727623		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	2228319		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	24708907, 28339425, 28974238	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	21204718, 29954240, 39230995	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	33172898	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	11348463	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	19470724, 26954716	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	20473280, 22052326, 28618949, 3014513	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	31350286	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	1309531	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	36140779	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	37655078	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12378623, 12436441, 14991929, 15078869, 15133868, 19948069, 21059911, 21499307, 2161812, 21659362, 21691299, 22302044, 22912812, 22962849, 23015317, 23031791, 23573174, 23874541, 24223834, 25081659, 25195135, 2545356, 26225650, 26462839, 26540347, 26546431, 27006471, 27088854, 27697092, 27728962, 27821810, 27894081, 28713927, 28902357, 29209123, 29303513, 29487225, 29690860, 29795057, 30382079, 30556858, 30672133, 30833661, 30940166, 31046781, 31127852, 31128068, 31298047, 31363003, 31426282, 31646557, 31717443, 31737652, 31739577, 31747859, 31754186, 32053284, 32116112, 32316188, 32479426, 32536483, 32685003, 33180829, 33268949, 33378016, 33434687, 33771191, 33818013, 34680125, 35039581, 35072355, 35414777, 35944892, 36033372, 36154076, 36380966, 36403194, 36403263, 36433941, 36513250, 36525476, 36587184, 36611819, 36896891, 36940837, 37380646, 37960718, 38019243, 38255847, 39251909, 40158169, 9365169	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19276364, 28258914	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21903590, 27465549	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	2631744	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	19475528, 30675277		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	17309600, 23062488	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	2200538, 33031101, 38237798	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	31229512	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	37236926	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10096250, 10453083, 11848469, 19369583, 19801959, 2125987, 22711262, 24155119, 26600535, 26939702, 27456363, 29423038, 29463565, 30819803, 30866868, 30968727, 31190871, 31761897, 7609100, 7747807, 9612689		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	24563233		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11017923, 11162866, 12466971, 1622116, 17308053, 18096271, 18256532, 18386774, 19287990, 19547694, 19914733, 20842459, 21406400, 22363436, 22407764, 23365639, 25748238, 26427040, 26483346, 26915294, 28231299, 29195073, 29254206, 29344953, 29698681, 30013058, 30258097, 30680798, 3089986, 31508368, 6646201, 8014012, 8149351, 9508209, 9594222, 9747881		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19524285, 23791828, 25204737, 26908019, 33081171, 33804458, 9475195	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24807963, 25855536, 28007776, 28720843, 31243599, 31311829, 31311847, 32200350, 32350415, 33099868, 33390837, 33525943, 33932087, 34419070, 34925373, 34930894, 36307773, 36346366, 36719686, 37063434, 37096681, 40216980	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35771494	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	12853350, 21982273, 22286234, 33547292	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17482131, 19061835, 19087307, 21725288, 21881486, 22159222, 22430804, 23176581, 23799849, 23951092, 24763884, 25227113, 27366943, 28281968, 29180625, 29559845, 30101629, 30675171, 31599407, 31870116, 32879494, 33725966, 35266008, 3536362, 35676472, 37481674, 37977044, 6961456	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	17469181, 28951314, 36216793, 36715552	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	10514383, 19596931, 24205356, 2631744, 27452220, 28339425, 29525942, 30683916, 31829519, 32108138, 33629937, 33925297, 36005200, 36012403, 36051475, 9462237, 9484827	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28679648	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	12237776	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	28899736		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15132769, 19524285, 21270607, 27483433, 28739735, 29435159, 30349298, 30422115, 30898650, 8972757		★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	31164413		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	2228319		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	25918253	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	27050951	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	27050951, 27974462	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20886042, 22052326, 23062488, 27050951		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	25130212, 26834242, 27687005	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	1341947, 29428974		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	29428974	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia and Hypogonadotropic Hypogonadism	Cerebellar ataxia and hypogonadotropic hypogonadism	Pubtator	14997205	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar medulloblastoma	Cerebellar medulloblastoma	BEFREE	1341947		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17444495, 24626956, 24662128, 29525942, 9286730		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	1672915, 17143621, 24626956, 24662128, 26808725, 30675277, 31771040		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	16325511, 17444495, 24626956, 24662128, 9286730, 9648593		★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	26919708	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15284595, 23997116, 24686171, 24829203, 25037230, 26857438, 27095570, 27987331, 29022749, 30930624, 3106693, 31247466, 7596184		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	10643003, 11008200, 11489822, 11958658, 12175339, 12910530, 12941792, 1374522, 16423996, 17102621, 17465989, 18317693, 19119907, 19134217, 19255330, 19584924, 20607354, 21129063, 21317922, 21324178, 21793975, 2180567, 22016811, 22139329, 22160402, 22340591, 22402744, 23578955, 23852775, 24186490, 24196163, 24231268, 24297863, 24708907, 24796395, 25533335, 25576913, 25739120, 27012813, 27040285, 27255663, 27775567, 27966820, 28159923, 28409891, 28504719, 29280516, 29511348, 29562177, 29682173, 29721192, 29880921, 30392813, 30445362, 30611741, 30626740, 30632221, 30725256, 30876441, 30901604, 30918335, 31160565, 31340195, 31382461, 31694585, 8529284, 9482408		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	17587243		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	23480758, 29976634, 30235453, 32173382, 32246704, 32453420, 35113866, 35758372, 37576707	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28964793		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	35897137	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	16868505, 24683550, 8679157		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	24683550	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	32915926	Stimulate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	16361637, 18624751, 28522217		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	28522217, 29138803, 35141331	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	28780352		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	12375038, 8144861		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Carcinoma	Choroid Plexus Carcinoma	BEFREE	29545198		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	31142360, 31727166		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	17297307	Stimulate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	32879494, 39227622	Associate	★☆☆☆☆ Found in Text Mining only
CHROMOSOME 8p11 MYELOPROLIFERATIVE SYNDROME	8p11 Myeloproliferative Syndrome	BEFREE	29720732		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	34220309	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	1468540		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16616107, 18477041, 18510704, 20014148, 20549547, 2069907, 2070052, 20817072, 20956327, 22086413, 22205151, 22623730, 23282972, 23560086, 24783269, 26466571, 26823509, 2682663, 26916070, 27572051, 27810071, 28321119, 31216925, 31631728, 31794600, 6603429, 8142618		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	24436278, 29907599		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31370719, 31829519		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27125275		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	LHGDN	12072203		★☆☆☆☆ Found in Text Mining only
Cleidocranial Dysplasia	Cleidocranial Dysplasia	BEFREE	29357927		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	35283023	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	1612482	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24118792, 31330513, 33299870	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	1377134, 1399125, 14695334, 15979100, 16940161, 1741403, 17726380, 19183865, 19690179, 20453196, 22666420, 24627270, 25185650, 25689483, 26768731, 27245242, 27566402, 28782841, 28899736, 28962550, 3089986, 31416966, 31623618, 3837853, 6646201, 7642726, 7759165, 7784081, 9135021		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	1586594	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11848471, 30403769		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	12189186, 15059925, 18283038, 21081470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	15493579, 1569190, 1586594, 16940161, 18802399, 19672269, 20841488, 23613397, 2542967, 27245242, 27273865, 2820714, 2876925, 3128541, 31370719, 32428045, 35438040, 36655275, 3837853, 6300869, 8325387, 8376401	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16543245		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	20383323	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Polyps	Colonic polyps	Pubtator	3511934	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10383126, 10523691, 10799331, 11172587, 1542492, 1568393, 15750208, 16882699, 17297307, 1874294, 19270520, 19561607, 19609274, 20232185, 2188234, 22127532, 22429595, 22558377, 22810696, 22976378, 23045412, 23752226, 24317174, 24390711, 24398765, 24627270, 24662484, 24889212, 25632068, 25659031, 25663692, 25934076, 26003165, 26036188, 26096932, 26152922, 26426996, 26487644, 26983878, 27245242, 27595705, 27619912, 27662660, 27678457, 28165564, 28377632, 28847964, 28933766, 29119627, 29267898, 29401653, 29434885, 29472532, 29512763, 30038405, 30221473, 30338942, 30460421, 30472235, 30575780, 30733532, 31027221, 31083525, 31300834, 31375671, 31685988, 31699039, 31734632, 31791342, 8960139, 9649157, 9727977		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	30510241		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11260862, 15750208, 1586594, 16308474, 16367922, 16543245, 16882699, 16940161, 17278192, 17297307, 17572360, 17848589, 17881904, 18694522, 18802399, 19064714, 19483300, 19561607, 19586553, 19691111, 19912441, 20065031, 20141613, 20696899, 21152119, 21252116, 21284881, 21298377, 2196264, 22072622, 22108803, 22190494, 22285861, 22310977, 22429595, 22547830, 22810696, 23045412, 23637971, 23951239, 24098375, 24244343, 24503701, 24598211, 24662484, 24695690, 24777251, 24919179, 25185650, 25201067, 25229241, 25386076, 2542967, 25500543, 25632068, 25659031, 25840688, 25895136, 26096932, 26426996, 26463716, 26506423, 26637399, 26678268, 26733171, 26860615, 27063727, 27080994, 27245242, 27273865, 27433286, 27595705, 27619912, 27793037, 27983919, 28081740, 28258094, 28377632, 28416735, 28675510, 28683746, 28764718, 28962550, 29119627, 29206819, 29258530, 29267898, 29364477, 29386092, 29507187, 29749530, 29754471, 29794421, 29986714, 30038405, 30575780, 30658502, 30733532, 30791232, 30999858, 31416966, 31450919, 31623618, 31646564, 31699039, 31734632, 32102509, 32140074, 32279400, 32297641, 32299194, 32439170, 32689938, 32737302, 33029691, 33078202, 33148262, 3325094, 33402467, 33432117, 33557648, 33754045, 33759958, 34201061, 34440739, 34440834, 34623601, 34669880, 34700030, 34819668, 35039060, 35120580, 35130122, 35221331, 35244540, 35468741, 35546072, 35857351, 35944892, 36077264, 36129915, 36233202, 36366788, 36596519, 36672275, 36734282, 36806631, 36896461, 37083591, 37110707, 37212463, 37377612, 37544925, 37596667, 37626036, 37705742, 37713993, 37781510, 37898661, 37950153, 38139419, 38163859, 38302412, 39456850, 39830506, 39849876, 40127075, 40185335, 40303483, 7799924, 8347498, 8393433, 8750149, 9508765, 9649157	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11751426, 1992440, 2193134, 22108803, 24960159, 25934076		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15126105, 16308474, 16367922		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22496461, 24240588, 28165564, 32258125, 38637125, 8376401	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	30510241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	40362536	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	23951239, 32102509	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	30412224	Stimulate	★☆☆☆☆ Found in Text Mining only
Complement Component C1s Deficiency	Complement component deficiency	Pubtator	31537905	Associate	★☆☆☆☆ Found in Text Mining only
Congenital bilateral aplasia of vas deferens	Congenital bilateral absence of vas deferens	Pubtator	32054096	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11257209, 15642390, 15860362, 16039948, 16080957, 18754028, 19673870, 19895612, 20817505, 22350583, 22563559, 22984125, 23225516, 24222112, 25827211, 26993771, 27810071, 2798426, 2830010, 28325354, 29344579, 29407586, 29884995, 31248901, 9388062		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29142067		★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	31584755		★☆☆☆☆ Found in Text Mining only
Congenital myasthenic syndrome ib	Congenital myasthenic syndrome	Pubtator	24589226	Stimulate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31196146		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17409424, 18809243, 21982273, 22155254, 23176581, 24657971, 25964345, 28739731, 2914707, 29796168, 2995998, 31423259		★☆☆☆☆ Found in Text Mining only
Cornelia De Lange Syndrome	Cornelia De Lange Syndrome	BEFREE	23106691		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31881747, 31886261	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	11788220	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	1612482	Stimulate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30794691		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	30794691	Associate	★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia	Cryoglobulinemia	BEFREE	3316385		★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	Pubtator	23025704	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	21173787		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	30598261, 32777768, 35843019, 36067639	Associate	★☆☆☆☆ Found in Text Mining only
De Lange Syndrome	De lange syndrome	Pubtator	23106691	Inhibit	★☆☆☆☆ Found in Text Mining only
De Lange Syndrome	De lange syndrome	Pubtator	29088292, 34849865	Associate	★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	19482502	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17974960, 31572500		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	18836552	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Denys Drash Syndrome	Denys drash syndrome	Pubtator	35667217	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	37928522	Associate	★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11733227, 18302196		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11733227, 18302196		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17355243, 36473131	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	29180625, 34031141, 35650387, 39464889	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27380896, 37028179, 40127075	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	17595242		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35932042	Associate	★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	22820187	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10378513, 10653866, 11182042, 11460166, 11697627, 15258997, 16327438, 1671647, 17175379, 17197434, 18024324, 18024371, 18445693, 18752503, 18754028, 19019431, 19038003, 19151788, 19278952, 19597184, 19638549, 19704118, 19816150, 19857547, 20016842, 20118770, 20303018, 20348878, 20378577, 20442643, 20498406, 20817505, 20823132, 21266718, 21692100, 21701491, 21740296, 22014048, 22018272, 22035756, 22120970, 22194861, 22213394, 22314191, 22510149, 22511926, 22665537, 22851565, 22967991, 23012230, 23313364, 23335369, 23348205, 23355209, 23363269, 23449635, 23599149, 23673335, 23716551, 23795946, 23821202, 23840064, 23892979, 23922484, 23939148, 24040459, 24222112, 24336156, 24397618, 24506200, 24614699, 24619762, 24674866, 24679006, 24719189, 24740248, 24931464, 25009295, 25090026, 25103070, 25124685, 25125624, 25199984, 25229766, 25284491, 25311243, 25337204, 25468432, 25529575, 25544753, 25581730, 25677902, 25696841, 25696842, 25741152, 25760242, 25805589, 25827211, 25828389, 26010683, 26158410, 26214636, 26218299, 26307073, 26340843, 26373676, 26421520, 26464726, 26541272, 26545844, 26573234, 26634708, 26773040, 26820684, 26850490, 26927665, 27003102, 27027803, 27071312, 27093450, 27125356, 27166590, 27282353, 27356265, 27419806, 27469075, 27633159, 27708232, 27816715, 27821509, 27980108, 28038709, 28153771, 28209136, 28212447, 28278726, 28288039, 28291124, 28327893, 28525305, 28552541, 28595732, 28639315, 28643426, 28686226, 28748558, 28776574, 28838257, 28860342, 28952038, 28985492, 29037890, 29088292, 29198442, 29250662, 29567771, 29623179, 29666157, 29674626, 29734016, 29738359, 29931583, 29936139, 29983382, 30099568, 30113335, 30252929, 30287880, 30382301, 30389217, 30496802, 30501868, 30523053, 30573511, 30666200, 30809101, 30874346, 30904045, 30953469, 30985716, 31028445, 31039827, 31050117, 31077320, 31109360, 31123088, 31171907, 31197205, 31243099, 31259656, 31285189, 31288832, 31315646, 31399522, 31498031, 31518494, 31527063, 31527075, 31615842, 31644584, 31721454, 31728727, 7687864, 8274734, 8695822, 9639522, 9787151		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	27356265		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	26221035	Associate	★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	31119774		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	16492768, 33220594, 38513239	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	11738392, 29523126		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11738392, 1309531		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	CTD_human_DG	29295717		★☆☆☆☆ Found in Text Mining only
Early infantile epileptic encephalopathy with suppression bursts	Epileptic Encephalopathy	BEFREE	31190871		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	25214561		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	27115168		★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	BEFREE	19789308, 22348395, 26373717		★☆☆☆☆ Found in Text Mining only
Enchondroma	Enchondroma	BEFREE	18624751		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	25683269	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23393560, 26656844, 8122249		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	26656844		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	37655078	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	14663583		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	14663583, 16681770, 1687493, 21305022, 21543766, 23028803, 23393560, 25214561, 26407074, 26656844, 26859414, 27572308, 29984790, 34831139, 35080085, 35269569, 35445736, 36140779, 37567170, 37859625, 38164180, 38536067, 40090626, 8122249, 9885379	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	26656844		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrioma	Endometrioma	BEFREE	19200988		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	16150151, 22884659, 26198055, 36510984	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26198055		★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	BEFREE	22654438, 26226842		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	32958266	Associate	★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa simplex Ogna type	Epidermolysis bullosa	Pubtator	28675510	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Idiopathic Generalized	Epilepsy	Pubtator	30675171	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15132769, 19524285, 21270607		★☆☆☆☆ Found in Text Mining only
Epithelioid hemangioendothelioma	Epithelioid Hemangioendothelioma	BEFREE	24384851, 26763770		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	2686538		★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Esophageal achalasia	Pubtator	20163722	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16490593, 17803656, 19084934, 28476684, 8131089		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16425431, 17317935, 19084934, 20890087, 24488669, 25925090, 33577050, 34284990, 34712552, 35879265, 36433943	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16490593, 17803656, 28476684		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	16490593		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24022664, 36624401	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10514383, 18084253, 21734802, 22450065, 22578181, 25925090, 26490982, 27721245, 27956804, 28591712, 28671049, 30551519, 31851786, 31856412, 31886273, 32252688, 32662828, 32714975, 33432363, 33476486, 34016746, 35593463, 35893895, 36624401, 36978187, 37417427, 40124272	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28336564, 29039480, 29397557, 29898995, 8695822		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	27781423, 9482408		★☆☆☆☆ Found in Text Mining only
Extraskeletal Myxoid Chondrosarcoma	Extraskeletal Myxoid Chondrosarcoma	BEFREE	23028803		★☆☆☆☆ Found in Text Mining only
Extravasation of Diagnostic and Therapeutic Materials	Extravasation of diagnostic and therapeutic materials	Pubtator	16848772	Associate	★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	36917862	Associate	★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	25351503	Associate	★☆☆☆☆ Found in Text Mining only
familial dilated cardiomyopathy	Dilated cardiomyopathy	Pubtator	36355424	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	18519675, 30353671		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	25290246	Associate	★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	33417873	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	24210820		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	27789406, 27789412	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibroadenoma	Fibroadenoma	LHGDN	15763593		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	7699198		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27125275, 30106235		★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	31816405		★☆☆☆☆ Found in Text Mining only
Focal cortical dysplasia of Taylor	Focal cortical dysplasia	Pubtator	20613634	Associate	★☆☆☆☆ Found in Text Mining only
Folic Acid Deficiency	Folic Acid Deficiency	BEFREE	29220669		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24953832, 25200035, 26028364		★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	BEFREE	25200035		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	24953832	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	16309200, 17036397, 18262050, 18932273, 20059402, 31582185		★☆☆☆☆ Found in Text Mining only
Gastric lymphoma	Gastric lymphoma	BEFREE	25634193, 9426402		★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	15188501	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	12377807, 31648989, 40185335	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	15864317, 21192842, 31570771	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	21192842, 28377632, 31570771		★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	12460470, 26337274, 32641029	Associate	★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	31765939	Inhibit	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	9334657		★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	21127729		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	9565066		★☆☆☆☆ Found in Text Mining only
Glaucoma 3 Primary Congenital A	Glaucoma	Pubtator	29453128	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11351043, 11381677, 11909963, 18694480, 19189656, 19602686, 23362460, 23715499, 23934175, 24196438, 25033601, 25050814, 26563484, 27119353, 27409345, 27852622, 27923907, 3001737, 30353492, 30828079, 30872592, 31685892, 31740732, 32705169, 33023892, 34072831, 34278448, 35380741, 36234681, 36235222, 36499054, 36834778, 37061119, 37147437, 38093312, 38159337, 38303029, 40649712	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	LHGDN	11909963		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	16204036, 21911485, 22068108, 24140063, 25490189, 27076630, 27119353, 27226604, 27409345, 27600094, 27852622, 3001737, 30401645, 30420702, 30771196, 30779712, 31266951, 31414301, 31427086, 31694585, 31740732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	21127729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	16204036, 21911485, 24140063, 25490189, 27076630, 27119353, 27226604, 27409345, 27852622, 3001737, 30401645, 30771196, 30779712, 30885118, 31266951, 31414301, 31694585, 31740732, 31754113		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	21127729		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11522296, 17572360, 22945648, 23934175, 23967279, 24325785, 27090007, 27282637, 28790340, 30795814, 30927504, 31740732, 32322592, 32916774, 33367952, 33712571, 33712887, 33953544, 34080022, 34134771, 34325590, 35645127, 35788723, 36224471, 36231068, 37147437, 38423596, 39533401, 8286200	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18426604, 18701488, 2028742, 27282637, 28060381, 29625108, 30779712, 30795814, 30914782, 31564901, 8256584		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	19020659		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	15208647, 1712408, 27730700	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	16848772, 32877461	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	19087307	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	35401560	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	8765976		★☆☆☆☆ Found in Text Mining only
Hairy cell leukemia variant	Hairy Cell Leukemia	BEFREE	9332472		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	8765976		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	31833149		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20614267, 21123375, 29790697, 30068946, 31833149, 32019273, 33859744, 37925449	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	19482502	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	25274755		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	23640436, 31196146, 32460775, 33518662, 35645616	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31196146		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	29569762		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	CTD_human_DG	17569031		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	BEFREE	20008140, 20949568, 21909081, 22121953, 22383169, 23012233, 23221487, 24091875, 24113311, 24384851, 24457083, 24983371, 25231439, 25893585, 26223194, 26440310, 26735859, 26763770, 27686553, 27960236, 28983701, 29104110, 29135507, 30251277, 31243333, 31805975		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	Pubtator	20008140, 20949568, 21909081, 22383169, 24091875, 26440310, 26632799, 31243333, 31805975, 32123305, 33016928, 34165212, 37350195	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangiosarcoma	Hemangiosarcoma	Pubtator	24983371	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	10339499, 16855632, 1954386, 23237561, 29462755, 33170359, 36536122, 36792656, 38223598, 6330529	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16452126, 23897499, 24686171, 25696841, 27694901, 28721678, 31068032, 31251903, 31743393, 9790509		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	15782131, 16537801, 21560252, 28498893, 6330529, 6683594, 8260894		★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	BEFREE	16196383		★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	Pubtator	16196383	Associate	★☆☆☆☆ Found in Text Mining only
Hemochromatosis type 4	Hemochromatosis	Pubtator	19846751	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	23809614	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	36088477	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23555992, 26916070, 27750045, 29209623, 29523126, 31739577	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	15133472, 16610058, 29118118, 7812011	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	37973687	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	17589519, 27197165		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	21059911, 33368532	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	12032322, 17908964, 21514380, 23468463, 25639871, 27782108, 29125598, 30394935, 32810332, 36368728	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	17171786, 21173787		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	BEFREE	28476807		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	24683001		★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	22706201		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	16685411, 30412224		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	20737197	Associate	★☆☆☆☆ Found in Text Mining only
High grade B-cell lymphoma with MYC and/ or BCL2 and/or BCL6 rearrangement	High Grade B-Cell Lymphoma With MYC And/ Or BCL2 And/Or BCL6 Rearrangement	Orphanet			★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	1638027, 1987477, 20303018, 22120970, 29769234, 29793519, 31399522		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10323217, 1342969, 16527615, 16614247, 20817505, 24761809, 26453442, 26565895, 26983958, 26988986, 27282353, 28432871, 8385158, 9609527		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	22955914, 25232062, 28432871, 35205272, 8385158	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	27708232	Inhibit	★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	28713902	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	29545198		★☆☆☆☆ Found in Text Mining only
Hyperammonemia	Hyperammonemia	Pubtator	28270654	Associate	★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	8364980	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31467597		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	20613634	Associate	★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	24913829, 32187665, 35878052, 37302654	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	14966904, 39369230	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	36473131	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	22000973		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	CTD_human_DG	22000973		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	30360984, 37409959	Associate	★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18087215, 19652553, 21712410, 22302044, 26919708, 27119353, 28978620, 31765939, 35013227	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18616527, 19596041, 20412594, 27793037, 30856376	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27656836, 28463531, 36068586	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	25984907		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	27362652, 36601116	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36578501	Inhibit	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20381452, 20570860, 2543982, 25717234, 31142360		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	1612482	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29788391		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	2573420, 26458824		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	24512691	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	24499724	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35266272	Inhibit	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	24960159		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	14966904, 15188501	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	22768805	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	20841488, 30624523	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	21538123		★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal Obstruction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	36029197	Associate	★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31195063		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	1309531, 16527609, 31350286		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	27050951		★☆☆☆☆ Found in Text Mining only
Isovaleryl-CoA dehydrogenase deficiency	Isovaleryl-CoA dehydrogenase deficiency	BEFREE	30273571		★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	24481037, 27318442, 31657576		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	22453922, 22882520, 23221487, 8952524, 9395180		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	24316489		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	12213716, 23619105, 25359993, 27793034, 28659618, 30817557, 31101622, 8204884		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	15208647, 33551436	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30212930	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28481271, 29341864		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	18544564, 21330408, 27774982, 32826868, 35108425, 37481674, 3803604	Associate	★☆☆☆☆ Found in Text Mining only
L2 Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	9402334		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	14562369, 22672838, 24563233, 27072211	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	22715132		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	21192842, 24820857		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	CTD_human_DG	21472269		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leiomyoma	Leiomyoma	Pubtator	31761932	Stimulate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	7997802	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	19633646, 21192842, 37175660	Associate	★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	21192842, 23012233, 24820857, 24908143, 26555296		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10488335, 10686942, 11106815, 15716988, 16855632, 17646409, 18593890, 19351371, 19535347, 1954386, 20113841, 20385359, 2069907, 20829716, 21949397, 22233804, 22547686, 23079661, 23161489, 24464582, 24586197, 25299775, 25828893, 26046133, 26058075, 26791235, 26871368, 27095570, 28790107, 29148541, 29407586, 29700286, 29743725, 30659143, 31196146, 31247466, 31251903, 31273062, 31649131, 3284178, 4079453, 6580529, 6603429, 7564512, 7680737, 8142618, 8260894, 8400234, 9402334		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10494147, 10918054, 10936867, 11070348, 11369651, 12855588, 1451597, 15528212, 15589822, 1646047, 16855632, 16955462, 17352239, 1747869, 17646409, 19137012, 19535347, 1954386, 2052620, 22031861, 22084162, 2211718, 22844532, 23037627, 23181557, 23759068, 24285714, 2437157, 24464582, 24612742, 24970385, 2506946, 25127121, 25140305, 25299775, 25501113, 25890196, 26220344, 26472107, 27317766, 28209136, 28275049, 2834731, 28490802, 28596280, 28805820, 2910363, 29148541, 29467491, 29622725, 30049824, 31196146, 3160729, 31649131, 31735627, 3194416, 32160736, 34236140, 34525179, 34584081, 34711640, 35020836, 3511091, 3520570, 35534379, 37148657, 37570631, 39465162, 6208953, 8125259, 8348968, 9770354	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	6330529	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	3496359	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1472633, 19137012, 26545364	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	1743296, 30049824	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11238126, 11380393, 1371419, 17046567, 18206725, 1967953, 23236401, 24200998, 24285714, 24677544, 24855276, 25006129, 25127121, 25605370, 25890196, 25989842, 26382622, 26744873, 28359056, 29227476, 29286103, 29467491, 29599201, 29626127, 29741984, 30576868, 30828079, 31357093, 31537905, 32068780, 32219447, 32245312, 3285345, 33170359, 33796404, 33860275, 34431643, 34525179, 34749168, 34873300, 35303440, 35590033, 35832114, 36520954, 36718632, 36976323, 37002311, 37047788, 37059710, 38002257, 6089208, 6961456, 8324225	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11698483	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26517351, 3513178	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Chronic	Myelomonocytic leukemia	Pubtator	32763828	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	31657576	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	17913706, 19408305, 2189894, 2435730, 26545364, 2684961, 27010069, 27486764, 2998760, 3277186, 3422230, 34404765, 3540012, 36536122, 39999580, 8243649	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	29148541		★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	24683001		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10087944, 10484978, 10686942, 10913679, 11380393, 11850082, 12580957, 15024077, 15163636, 15581842, 16452126, 1764535, 18393360, 18656691, 1967953, 20193852, 20804918, 21059853, 22911553, 24166297, 24363325, 24435446, 24525236, 24576034, 24855276, 25280219, 2542700, 25487600, 25800664, 25956709, 26382622, 26517351, 2653488, 26791235, 26856970, 26868909, 27376689, 27389055, 28362701, 28541716, 28900115, 29080039, 29741984, 29744585, 29958106, 30587342, 30635567, 31574286, 31623866, 3165487, 7507702, 7950916, 8445953, 9379677, 9443078, 9790509		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	11850082, 12031912		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	25956709		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	24481037, 27318442		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	17483057, 27125305, 2834731, 31266772, 3194416, 3466870, 3957347, 9614908		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	35283023	Inhibit	★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	21192842, 24820857		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	21292635		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	12635143		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	25622542, 36514176	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	36514176	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	9808433		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Pleomorphic	liposarcoma	BEFREE	12635143		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10461064, 11148566, 12378623, 12603528, 1335794, 14687479, 15668888, 16257012, 16616001, 17698969, 18161050, 19035462, 19637194, 19963110, 20380719, 21262914, 21499307, 2154325, 21573126, 22262416, 22460906, 22580498, 22653869, 22847158, 22912812, 23583198, 23874541, 24002871, 24038073, 24104553, 2415125, 25108398, 25128497, 2548493, 25768320, 25915584, 27006471, 27194100, 27197165, 27213815, 27246112, 27409345, 2843452, 28481866, 28607447, 28697339, 28869604, 28964793, 29464015, 29507693, 29690860, 29795111, 30007230, 30015413, 30382079, 3040653, 30458889, 30760754, 30770740, 30788663, 30833661, 31128068, 31186238, 31293639, 31691159, 31739577, 7511953, 8198385, 9275322		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	12029619, 15565109, 29698666, 9029167		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14991929, 15459488, 17587243, 18937283		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12378623, 27125275		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	11559656	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	19276364, 31292535, 31772606	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	29690860, 35338348	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	11532874, 8807143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	16257012, 20380719, 2154325, 21573126, 22182413, 22326218, 22653869, 23038063, 2415125, 25128497, 27197165, 27614046, 28219903, 28273073, 28734833, 30378283, 30643286		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	LHGDN	18722373, 19061838		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Neoplasms	Liver neoplasm	Pubtator	20380719, 21059911, 26810065, 30378283, 30944375, 36896891, 37053209	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Low Grade Lymphoma (neoplasm)	Low Grade Lymphoma	BEFREE	2196779, 23276184		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	32457348	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12378599, 12876208, 1306309, 15210690, 1645569, 16790082, 19547694, 22363436, 22693540, 23365639, 23776433, 24132637, 25299775, 25895136, 26035432, 2631744, 26356817, 26483346, 27453422, 27458097, 28231299, 28592245, 28623290, 28878262, 29257330, 29507620, 29750778, 30258097, 31591389, 31894338, 32051824, 32706069, 33014186, 33099479, 33136091, 33237626, 33355622, 35328482, 36035842, 36142846, 36333840, 36357457, 36681772, 37041291, 37384411, 37666882, 37858127, 3801273, 38032932, 38233864, 9045892, 9617337	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	16289808, 28191284		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	18461184, 20737197, 21974937, 22326218, 25299775, 27593925, 29254206, 31114017, 8014012		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	2056195, 26175399, 2776356, 3311495	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	3701256	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	9822266	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17278192, 23717612, 24053468, 25840688, 28671049, 29984790, 31870116, 36999462, 38065972, 7903963	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24488669, 29364480, 32297641	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	20008140	Associate	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	2070052		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	14576768, 22547686, 22563559, 22911553, 23673335		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10706881, 11526483, 11697627, 12169201, 12670331, 15095297, 15716988, 15735016, 15852472, 16094360, 16169462, 16325511, 1638027, 16616107, 17011988, 1713514, 17589519, 17608773, 17907813, 18461184, 18535662, 18713946, 18765521, 18923440, 19010825, 19197161, 19337983, 19363496, 19535347, 19597184, 19628709, 19636063, 1992441, 2022596, 20660329, 20661666, 20817505, 20823132, 20956327, 20962620, 21119107, 21156254, 21245140, 21491965, 21498549, 21560251, 21949397, 21969595, 21974937, 22002575, 22035756, 22308267, 22479645, 22484426, 22546857, 22899491, 22929980, 23012230, 23079660, 23171357, 23178486, 23330001, 23348205, 23416976, 23538750, 23573174, 23600716, 2386973, 24222112, 24394940, 24395247, 24648290, 24731854, 24998853, 2506953, 25103070, 25143484, 25199984, 25337204, 25581730, 25692307, 25827211, 25916698, 25953460, 26158410, 26224092, 26229090, 26434591, 26489677, 26490423, 26545844, 26820684, 26832406, 26834124, 26892631, 26962682, 26983958, 27093450, 27339797, 27391453, 27419806, 27717585, 27810071, 27821509, 27913503, 28288039, 28375188, 28498285, 28521631, 28614202, 28648593, 28659618, 28686226, 28711572, 28776574, 28844114, 28868942, 28952038, 29272887, 29310838, 29327714, 29629947, 29722657, 30069049, 30134175, 30448222, 30496802, 30734478, 30874346, 30877298, 31039827, 31142587, 31171817, 31257681, 31288832, 31615842, 31785002, 3284178, 6330529, 6603429, 7535586, 7623799, 7698223, 8012955, 8260894, 8274734, 8695812, 9044511, 9169090, 9196434, 9484350, 9494610, 9610616, 9787151		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10706881, 11904304, 12594230, 12670331, 14592832, 15150404, 16258503, 1638027, 16418334, 16507780, 18645192, 19022773, 19106104, 19535347, 19597184, 20118770, 20348878, 20823132, 21460242, 21502403, 21560251, 21560252, 21628860, 21803762, 2200538, 22844532, 23150777, 23171647, 23276184, 23341189, 23538750, 23600716, 23995111, 24152439, 24179151, 24625454, 24761809, 24815991, 2506953, 2509518, 25103070, 25299775, 25541715, 25612555, 25692307, 25839159, 26229090, 26351698, 26464726, 26565895, 26717387, 27166259, 27282353, 27339797, 27469075, 27523007, 27773559, 28061782, 28398499, 28686226, 28724379, 28771100, 28776574, 28801451, 29037890, 29327714, 29785017, 29793519, 30012920, 3004617, 30181564, 30348671, 30523053, 30523719, 30701204, 30707764, 30918199, 30953469, 31127909, 31142587, 31171907, 31189479, 31209069, 31288832, 31391404, 31712669, 31805190, 31844144, 31901912, 31945157, 31997133, 32216817, 32239695, 32273477, 32311849, 32362635, 32497402, 32659596, 32664092, 32780847, 32843697, 33399078, 33530253, 33591648, 34105893, 34304248, 34608246, 34632715, 34728235, 3491176, 3496359, 3521694, 35316216, 35443279, 35482553, 35715938, 36196757, 36861520, 37070973, 3714470, 37147953, 37198234, 37314811, 37567974, 37643767, 37768948, 37882668, 38049665, 39375391, 39905397, 40651974, 6330529, 7623799, 7718884, 8274734, 8286743, 8386027, 9610616	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	12213716, 15716988, 18535662		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	23573174, 24943107, 30610086	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	12077300, 14508797, 1485535, 1638027, 19597184, 22168746, 24388756, 26464726, 27117536, 27390358, 28984304, 29793519, 30012920, 30213873, 31844144, 33168041, 33768318, 34788985, 35443279, 36200794, 36575003	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	1342969, 15613866, 1562738, 1638027, 18089500, 18297523, 18945749, 19019431, 19351371, 19597184, 21088162, 21286717, 21736761, 22194861, 24388756, 26261669, 26464726, 27203548, 27544800, 28515100, 28653191, 28730642, 28984304, 29310838, 29793519, 30213394, 30213873, 30874346, 31039827, 31631728, 31844144, 8280621		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	18297523, 25807917, 30481117		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17065002, 18297523, 18754028, 18981293, 20087644, 20303018, 2189291, 21956115, 25656914, 25807917, 2840989, 30481117, 31645904, 6324175, 6330529, 6420706, 7954347, 8580815, 9331562		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	18297523, 18754028, 20303018, 2189291, 25656914, 25807917, 30481117, 31645904, 6324175, 6420706, 7954347, 9331562		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	BEFREE	8025268, 8515068		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Noncleaved-Cell	Lymphoma	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	19211505, 30018745		★☆☆☆☆ Found in Text Mining only
Lymphoma, Undifferentiated	Lymphoma	BEFREE	30907476, 3128772		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	11896204, 34511544, 3491176	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	23791008, 26305986		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	30412224		★☆☆☆☆ Found in Text Mining only
Macrocephaly	Macrocephaly	BEFREE	29745900		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28060381, 29069732		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	31833149		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	12481006, 12580957, 15370207, 21119107, 23079660, 23313364, 23330001, 24683001, 26100211, 27776009, 28626618, 30115641		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	28861328		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	22016811, 3001737		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10383126, 10567899, 10639563, 10652430, 10741284, 11104567, 11175856, 11738392, 12007633, 12036924, 12851682, 14729606, 14760071, 15083194, 15286719, 15354213, 15656577, 15743499, 15757889, 15803183, 16331604, 16423995, 16527609, 17066426, 17158641, 17908964, 18199546, 18348306, 18373870, 18497068, 18925859, 18996220, 19242061, 19270750, 1961733, 19690609, 19740597, 20139910, 20144848, 20886042, 21226903, 21346144, 21575199, 21646475, 21808024, 21909081, 21986497, 22056952, 22152285, 22581054, 22612343, 22863309, 23145106, 23300383, 23393560, 23555992, 23649631, 23776131, 23813010, 23965903, 24316975, 24444383, 24927563, 25270118, 25363551, 25531321, 25537515, 25636967, 25683269, 25716159, 26180042, 26331541, 26452386, 26490253, 26735859, 26758430, 26822264, 26950360, 26954716, 27208794, 27283966, 27775705, 27795300, 27811364, 27852327, 27899639, 27960236, 28089283, 28160502, 28186965, 28192473, 28215225, 28464854, 28490334, 28696357, 28709002, 28716678, 28870680, 2915899, 29181861, 29185119, 29212204, 29243807, 29480818, 29523126, 29523784, 29545595, 29622465, 30018709, 30149665, 30248461, 30266755, 30324719, 30420657, 30524945, 30526553, 30688660, 30703514, 30728358, 30746633, 30777332, 30843188, 30885118, 31144531, 31326549, 31570853, 31577739, 31763993, 31775037, 7607564, 7880720, 7913873, 8124858, 8432027, 8455947, 8492318, 8814449, 9164674, 9187125		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16490593, 17803656, 18493233, 2459070, 28476684, 28830912		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24953832, 25200035		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	31648989, 9809036		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	27774982, 3803604		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	11532874, 8807143		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	22556267, 22580498, 22653869, 26513297, 28273073, 28377632, 28607447, 30697791, 30833661		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11017923, 11162866, 12466971, 1622116, 17308053, 18096271, 18256532, 18386774, 19547694, 19756735, 19914733, 20842459, 21406400, 22363436, 22407764, 23365639, 24976536, 25748238, 26427040, 26483346, 26915294, 27593925, 28231299, 29195073, 29254206, 29344953, 29698681, 30013058, 30258097, 30680798, 3089986, 31508368, 3167852, 6646201, 8014012, 8149351, 9508209, 9594222, 9617337, 9747881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	16289808, 28191284		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	21292635		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12707044, 15132769, 20647308, 21270607, 26227489, 27483433, 28739735, 29435159, 30349298, 30422115, 30898650, 8972757		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	20852632		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11950922, 22833572, 25807524, 26108419, 26119937, 27406986, 27721407, 28249168, 28377488, 31311847, 31562613, 31662451		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	25961927		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10029066, 10564591, 10754496, 10797498, 11733359, 12386920, 14522256, 14997205, 15937962, 16267836, 16423995, 17070983, 17319789, 18190704, 18542058, 18567993, 18670647, 19095950, 19549893, 19562729, 19578399, 19773438, 20026909, 20515470, 20627891, 20634801, 20820186, 21685943, 21822302, 21860423, 21941025, 22048240, 22281794, 22585990, 22585994, 23609948, 23720054, 24130167, 24590455, 24783269, 24953652, 25115192, 25201220, 25322691, 25505253, 25770188, 25829425, 25973080, 26279298, 26347108, 26554830, 26799514, 26887047, 26934861, 27159573, 27181203, 27341160, 27550065, 27923366, 27935821, 28139275, 28202510, 28212321, 28412251, 28507054, 28592703, 28653607, 28721678, 28888037, 29141848, 29358129, 29415999, 29530947, 29665565, 29716963, 29719262, 29720450, 29851094, 29959569, 30086259, 30098506, 30100187, 30280090, 30340213, 30609075, 30733194, 30808975, 30846826, 30863497, 30914434, 31145683, 31554818, 31560094, 31594836, 31704724, 9551622		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17173048, 23704919, 29295717		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	27510158		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17036397, 18932273, 19302034, 20737197, 23717612, 23925667, 24053468, 24362523, 24670359, 25047501, 25618371, 26460485, 26514491, 27863420, 28852313, 30396071, 30410872, 31645899, 31701767, 7664243, 9369962, 9809036		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	17171786, 21173787		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	21226903, 22986535, 30768848		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10096250, 11848469, 19369583, 19801959, 2125987, 22711262, 24155119, 26600535, 26939702, 27456363, 29423038, 29463565, 30819803, 30866868, 30968727, 31190871, 31761897, 7609100, 7747807, 9612689		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	2228319		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10071077, 10092127, 10192393, 10378696, 10616529, 11139316, 11807957, 12169201, 12420224, 12507816, 12580957, 12635143, 12769686, 12893289, 14498825, 14552656, 14603447, 15082916, 15163636, 15267185, 15519529, 15574759, 15644444, 15688022, 15688392, 15743832, 1575012, 15796198, 15930260, 15937962, 15940261, 16039948, 16130124, 16210249, 1649348, 16508012, 16537801, 16856965, 16888615, 16984727, 17109766, 17297307, 17371266, 17444495, 17543856, 17589519, 17675364, 17724465, 17942906, 18000363, 18006816, 18037408, 18046334, 18190704, 18242516, 18302196, 18454692, 1851085, 18535662, 18577746, 18766298, 19084934, 1916760, 19174520, 1923512, 19270520, 19270750, 19302034, 1933191, 19497851, 1954177, 19561607, 19584924, 19628709, 19763338, 19789308, 19843847, 20065031, 2011401, 20331630, 20346013, 20399964, 20404562, 20549547, 20643922, 20940401, 20980433, 21031437, 21109931, 21245140, 21447796, 21447800, 21460180, 2154325, 21573126, 21678469, 21693596, 21814200, 21814516, 2185684, 21878679, 21949397, 21986497, 22039435, 22350583, 22371336, 22464321, 22500694, 22556267, 22581054, 22623531, 22623730, 22710719, 22885699, 22898541, 22911553, 23029531, 23045412, 23079660, 23118011, 23129625, 23176581, 23178486, 23331925, 2334929, 23475876, 23566090, 23568779, 23681918, 23792448, 23821669, 23825064, 23887393, 23897499, 23897900, 23906881, 23925667, 23965898, 24006065, 24086436, 24104394, 24130167, 24152672, 24173829, 24261995, 24285728, 24394940, 24444383, 24492847, 24591535, 24594601, 24596200, 24612742, 24645771, 24657971, 24662128, 24786788, 24789877, 24853183, 24866769, 24890832, 24890833, 24927563, 24985129, 24985130, 24998853, 25034695, 25048629, 25085992, 25139102, 25199984, 25200035, 25274755, 25277734, 25286758, 25311243, 25315430, 25332683, 25341931, 25384704, 25452129, 25452213, 25495526, 25529575, 25578561, 25622542, 25647305, 25663692, 25818646, 25875098, 25893605, 25970242, 26096932, 26119937, 26152922, 26277543, 26282204, 26286633, 26331541, 26373717, 26382145, 26382622, 26383167, 26427040, 26434591, 26453442, 26483346, 26729287, 26778668, 2682665, 26832406, 26833129, 26844271, 26850841, 26896855, 26939702, 26983878, 27074591, 27104757, 27144522, 27197165, 27239040, 27241520, 27328849, 27366943, 27406986, 27447861, 27448979, 27463019, 27474149, 27590350, 27594045, 27600094, 27655693, 27678457, 27773673, 27840026, 27852622, 27864144, 27899379, 27899423, 27903583, 27980108, 28055963, 28073841, 28134728, 28152508, 28174209, 28230739, 28232072, 28249000, 28262675, 28270499, 28292893, 28336564, 28362357, 28367990, 28377488, 28398229, 28420161, 28466200, 28490664, 28583252, 28587062, 28590415, 28643779, 28671049, 28684529, 28704924, 28729418, 28806396, 28843484, 28861328, 28888037, 28951456, 28974715, 28984200, 29080556, 29086571, 29106503, 29127156, 29141848, 29171017, 29180466, 29180471, 29180509, 29190822, 29202477, 29256636, 29267898, 29305708, 29321378, 29397557, 29435159, 29467490, 29474069, 29491003, 29511348, 29596783, 29622465, 29669762, 29728583, 29797253, 29856950, 29885057, 29970880, 29997223, 30018745, 30043475, 30047092, 30050304, 30076412, 30139745, 30158517, 30172452, 30181285, 3020069, 30257881, 30281155, 30340042, 30343319, 30378283, 30422115, 30447009, 30453475, 30470303, 30470836, 30510261, 30599408, 30675277, 30701532, 30753823, 30760754, 30767760, 30883984, 30894502, 31015843, 31043611, 31066450, 31068032, 31083525, 31097545, 31097636, 31097695, 31102666, 31167905, 31262815, 31292158, 31309249, 31341534, 31357093, 31392631, 31399583, 31416966, 31442917, 31501192, 31527063, 31606655, 31631728, 31636382, 31648989, 31748534, 31767764, 31790487, 3186743, 3466870, 3529089, 3619899, 6419124, 8256584, 8432027, 8545130, 8707290, 8755507, 9012485, 9388062, 9389570, 9443078, 9772916, 9790502		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	11559025		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17444495, 24626956, 24662128, 9286730		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	12189186, 15059925, 18283038, 21081470		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14695334, 16940161, 17726380, 19183865, 19690179, 20453196, 22666420, 24627270, 25185650, 25689483, 26768731, 27566402, 28782841, 28962550, 3089986, 31416966, 31623618, 6646201, 7642726, 9135021, 9809036		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	26646563	Stimulate	★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10383126, 11585056, 12032322, 12353235, 17656250, 18401664, 18925859, 19690609, 20133671, 20735817, 21822287, 22430491, 24147022, 27775705, 29180466, 29523126, 30359947, 30746633, 7910618, 8605112, 9164674, 9310246		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11916966, 12362975, 15743499, 15756435, 16107734, 16996503, 17170079, 17485441, 17726380, 18059336, 18349290, 18586674, 18714337		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	10602433, 12481006, 12580957, 12742154, 15370207, 15718413, 18398742, 19594747, 21119107, 21945515, 22259787, 23079660, 23313364, 23330001, 24683001, 25199984, 26022239, 26100211, 26517511, 27776009, 27864294, 28028120, 28626618, 30115641		★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	19019431, 28038709, 30213394		★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	28675510		★☆☆☆☆ Found in Text Mining only
Mature B-Cell Neoplasm	B-Cell Neoplasm	BEFREE	19535347		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	15842661, 17011988, 1713514, 31728727		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	10643003, 11008200, 11489822, 11958658, 12175339, 12910530, 12941792, 1374522, 15328187, 15519529, 16423996, 17102621, 17465989, 17522332, 18317693, 19119907, 19134217, 19351822, 19584924, 2048223, 20607354, 21129063, 21317922, 21324178, 21793975, 2180567, 2192793, 22016811, 22139329, 22160402, 22340591, 22402744, 23578955, 23852775, 24186490, 24196163, 24231268, 24297863, 24493713, 24708907, 24796395, 25533335, 25576913, 25739120, 26373717, 27012813, 27040285, 27255663, 27775567, 27966820, 28159923, 28409891, 28504719, 29280516, 29511348, 29562177, 29682173, 29721192, 29880921, 30392813, 30420702, 30445362, 30611741, 30626740, 30632221, 30725256, 30901604, 30918335, 31160565, 31340195, 31382461, 31694585, 8529284, 9482408		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	11770900, 11916498, 11958658, 17254356, 17465989, 18059365, 18593994, 19134217, 19584924, 19594892, 20921458, 21098324, 21324178, 21793975, 22016811, 22090452, 22147345, 22402744, 23082872, 23659115, 23852775, 24493713, 24708907, 25576913, 25853389, 25915540, 25970789, 26290144, 27255663, 27449089, 29280516, 29377550, 29511348, 30205044, 30392813, 30445362, 30632221, 30901604, 31694585, 31996670, 32410663, 32539808, 32683405, 32822486, 33430425, 34477871, 35307743, 35831448, 36273157, 36368321, 37486991, 37599362, 37783879, 40335697	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	LHGDN	16423996, 16478988, 18593994		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	BEFREE	18021376, 22147345		★☆☆☆☆ Found in Text Mining only
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	19270706		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	11139316, 22020039, 9138112		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10209447, 10897006, 11139316, 11223543, 15548813, 16977458, 18677108, 18679422, 21822300, 22555175, 23792459, 24595456, 2512356, 29383100, 30651597, 31584755, 9138112		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11139316, 11250904, 12721301, 12824159, 15153331, 15221868, 17218782, 18677108, 18679422, 19421315, 19898689, 19934275, 20499280, 2121834, 21497295, 21822300, 22555175, 23249808, 23792459, 24200969, 24595456, 25835050, 29212027, 30795533, 32933177, 33554439, 3402430, 35441564, 35688842, 36233342, 37024284, 38065972, 38615585	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12824159, 16410805, 18679422		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25444926	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31820036	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma Amelanotic	Melanoma	Pubtator	22555175	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	10209447	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	11139316, 17094481, 38615585	Associate	★☆☆☆☆ Found in Text Mining only
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	19270706		★☆☆☆☆ Found in Text Mining only
MELORHEOSTOSIS, ISOLATED	Melorheostosis	BEFREE	1306305, 3244364		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	30515781		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	11311470, 17473381		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18808065		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	18808065, 27007654, 32832554, 8343222	Associate	★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	CTD_human_DG	25277525		★☆☆☆☆ Found in Text Mining only
Mesenchymal Chondrosarcoma	Mesenchymal Chondrosarcoma	BEFREE	1317500		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	24598211	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	24926545, 27705913	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	18677108		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	19276271, 26554830		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	39176099	Associate	★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	12759924, 19396865		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	22084162, 27789709	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34646389	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitochondrial encephalopathy	Mitochondrial encephalopathy	Pubtator	27345796	Associate	★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	18242516, 21468039, 24518206		★☆☆☆☆ Found in Text Mining only
Monocytosis	Monocytosis	BEFREE	24436278		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	19200988, 21556123	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	37656618	Stimulate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	14672406		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	21292635, 21795698, 23552692, 36012403	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	8972757		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	29555661		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis VI	Mucopolysaccharidosis	Pubtator	38006675	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	11182042, 11699208, 17197434, 18445693, 25337204, 28038709, 30213394, 31631728, 9196434, 9395180		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10618400, 1415486, 14531906, 15491286, 16497877, 18381641, 18641367, 18647998, 19074889, 19144381, 19395026, 19454499, 2070052, 20974848, 21223249, 21468039, 22489701, 22806891, 22972034, 22996653, 23179058, 23582323, 2423157, 24844357, 25197055, 25961916, 25978432, 26080835, 26087190, 26282073, 26430725, 26847058, 26907633, 27145280, 27833099, 27863261, 27882933, 28052011, 28086949, 28550183, 29321378, 29344579, 29462755, 29654271, 29884741, 29954751, 30285865, 30696815, 30880156, 31015454, 31221783, 31743393, 31844041, 32079692, 32145111, 32471990, 3275865, 32992461, 33008815, 33061303, 33392515, 33757979, 33854043, 34233962, 34258103, 34346292, 34864816, 35203396, 35328342, 35441564, 35544413, 35643867, 35985681, 36059274, 36121114, 36223594, 36672841, 36747009, 36752202, 36846090, 37700273, 37767768, 37934799, 39312195, 39596160, 7812011	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12759924, 1415486, 14531906, 14697640, 1563831, 16569345, 16793349, 16829212, 18242516, 18381641, 18759374, 19259613, 19454499, 20018915, 2004018, 20190818, 20348882, 20404562, 20974848, 21468039, 21941367, 2208106, 22451422, 22498740, 22772059, 22806891, 22972034, 23174883, 23582323, 23599149, 23752175, 24496825, 24518206, 24782505, 24844357, 25197055, 25199984, 25384216, 25498913, 25589346, 25941352, 26087190, 26771839, 26869462, 26907633, 27484817, 27773931, 28369725, 28490664, 28751557, 29050200, 29156762, 29321378, 29467490, 29472861, 29551594, 29797253, 29882166, 29999206, 30068698, 30300141, 30481117, 30510245, 30553464, 30850386, 31015208, 31015454, 31093282, 31221783, 31277689, 31514052, 31743393, 3275865, 7680737, 7812011, 8652383, 8760292, 9308251, 9406577, 9666801		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12970749, 18647998		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	19636021, 7742531	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27738323	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30463275, 31212712, 37236124	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	22265745		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Facioscapulohumeral	Facioscapulohumeral muscular dystrophy	Pubtator	28273136	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	29127875		★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	33510225	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	8286826	Stimulate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	27473081	Associate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	CTD_human_DG	10914558		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	1468540, 15163636, 16452126, 23320102, 25487600, 26382622, 30737486		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	11722413, 26382622, 28539603, 34749168, 8943864	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22524974	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myeloid Leukemia	Myeloid Leukemia	BEFREE	21059853, 2156260, 26545364		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12580957, 16293596, 16685411, 17284533, 21460180, 21503936, 21693596, 22710719, 22911553, 2406517, 2542700, 25611295, 25647305, 25828893, 26179066, 27825294, 28515100, 30049824, 30054832, 7758616, 8656667, 8704208, 9766750		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	22911553, 24436278		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	28972002	Stimulate	★☆☆☆☆ Found in Text Mining only
Myofibrillar Myopathy	Myofibrillar myopathy	Pubtator	37748332	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	35586671	Associate	★☆☆☆☆ Found in Text Mining only
Myopia, Degenerative	Myopia	BEFREE	30611020		★☆☆☆☆ Found in Text Mining only
Myositis Ossificans	Myositis	Pubtator	37307755	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	24027017	Associate	★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29274549		★☆☆☆☆ Found in Text Mining only
Myxoma	Myxoma	BEFREE	30900156		★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	28382141		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	11776079, 12490316, 20053927, 23681229, 23758864, 24157866, 24884612, 25762617, 28029649, 30662535, 31025872, 31703161, 9594347		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	19698176, 20440510, 22588558, 23601184, 24157866, 24814906, 26993269, 30141114, 30226609, 30718276, 31703161, 32767326, 32964977, 32985354, 35441564, 35778755, 36199071, 36382614, 37257705	Associate	★☆☆☆☆ Found in Text Mining only
Native American myopathy	Native american myopathy	Pubtator	34529278	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22084162	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10096250, 10323217, 10337661, 10378696, 10449034, 10461064, 10481784, 10491435, 10499637, 10564591, 10602433, 10897006, 10913671, 10969942, 11241788, 11257209, 11275991, 11286645, 11303627, 11471486, 11526483, 11568558, 11578259, 11598174, 11675133, 11733359, 11738392, 11786932, 11817538, 11950922, 11958658, 12007633, 12076699, 12353235, 12370803, 12545167, 12565816, 12632500, 12738730, 12759924, 12767524, 12769686, 12802290, 12841388, 12851682, 12853350, 12909717, 1309531, 1317726, 1326470, 1335792, 1377134, 14581353, 14760071, 14997205, 15095297, 15224347, 15267185, 15291367, 15314163, 15328187, 1542492, 15491757, 1552612, 15574759, 1563831, 15734970, 15735016, 15743499, 15809970, 15994934, 16179497, 1622111, 16310933, 16325511, 16466985, 16471312, 16523260, 16537801, 16682952, 16697040, 1671647, 16829212, 16856965, 16878133, 16908535, 16984727, 17028598, 17080715, 17143621, 17158641, 17192869, 17350464, 1737370, 1739619, 1741403, 17414096, 17431415, 17457227, 17589519, 17622571, 17698969, 18042711, 18096271, 18190704, 18268409, 18297523, 1829952, 18317693, 18369647, 18381641, 18461184, 1849033, 18535662, 18593890, 18704466, 18713946, 18766298, 18925859, 18955973, 19022773, 19174520, 19197161, 1923512, 19258428, 19282668, 19406837, 19453846, 19483300, 19562729, 19578399, 19584924, 19620247, 19636063, 19690137, 19755676, 19766114, 19815507, 1984840, 19907434, 19921788, 19946337, 19963116, 19996588, 2000945, 20016842, 20053927, 20139910, 20160479, 20393505, 20399964, 20473280, 20501848, 20634801, 2070052, 20735817, 20799767, 20820186, 20823132, 20921458, 20962620, 20980433, 21156243, 21217079, 21262914, 21270607, 21289283, 21324178, 21468039, 21490439, 21491965, 21536730, 21557726, 2156260, 21573126, 21685915, 21693596, 2180567, 21808024, 21822287, 21856782, 21860423, 2188234, 21911485, 21941367, 2196779, 21969595, 21974937, 21986497, 22002575, 22048240, 22067385, 22139329, 22155254, 22160402, 22222631, 2227545, 2227549, 22281794, 22314191, 22340591, 22460906, 22464321, 2249657, 22546857, 22580498, 22581054, 22605478, 22754359, 22839576, 22869753, 22897848, 22911553, 23012233, 23062488, 23155275, 23178486, 23209150, 23251464, 23276184, 23280764, 23342141, 23441611, 23552692, 23555992, 23574779, 23578955, 23599149, 23609948, 23631722, 23717612, 23722468, 23775715, 23778407, 23860775, 23874405, 23897499, 23897900, 23901000, 23965903, 23970286, 24030976, 24038073, 24041470, 24053468, 24089139, 24104394, 24140063, 2415125, 24157871, 24196163, 24197134, 24222112, 24296348, 24302556, 24336156, 24362523, 24390711, 24397618, 24477574, 24501305, 24518206, 24521492, 24576034, 24581491, 2460228, 24645771, 24657971, 24679006, 2470097, 2477687, 24796395, 24820857, 24858378, 24890832, 24890833, 24899509, 24960159, 24985129, 24998853, 25012251, 25038584, 25043018, 25085992, 25090026, 25103070, 25108398, 25125625, 25139102, 25200035, 25214561, 25286758, 25299775, 25351246, 2537119, 2540905, 25452129, 2545356, 2548493, 25533335, 25544753, 25546234, 2557616, 25602521, 25613309, 25717234, 25805589, 25818646, 25820259, 25855536, 25893605, 25934076, 25970789, 26222673, 26223194, 26254776, 26282204, 26373717, 26416427, 26420814, 26426741, 26427040, 26434591, 26461086, 26489677, 26490253, 26514491, 26517511, 26522729, 26541272, 26573234, 26643319, 26723934, 26778668, 26797085, 26822264, 2682665, 26826706, 26833129, 26834124, 2687767, 26887047, 26898756, 26939702, 26950360, 26966191, 27012811, 27012813, 27044823, 27074591, 27119353, 27144522, 27159573, 27184134, 27194100, 27197165, 27207013, 27213815, 27226604, 27267444, 27356265, 27376737, 27397723, 27406986, 27409345, 27440272, 27452220, 27521276, 27528625, 27708232, 27742070, 27748763, 27773559, 27773931, 27775567, 27775705, 27810071, 27816715, 27821509, 27852327, 27890933, 27923907, 27980108, 28036290, 28073841, 28076844, 28089889, 28134936, 28137659, 28137841, 28152508, 28187036, 28209368, 28219903, 28232072, 28233639, 2823933, 28249000, 28292893, 28297567, 28333115, 28342098, 28377488, 2838785, 28393404, 28409891, 28420161, 28430874, 28445515, 28481271, 28521631, 28591712, 28592703, 28619753, 28626618, 28639315, 28653607, 28653878, 28671049, 28675510, 28676221, 28686226, 28696357, 28704924, 28716678, 28737478, 28780352, 28801349, 28806396, 28815764, 28821631, 28848040, 28860342, 28870680, 28974715, 29080353, 2908290, 29088292, 29106388, 29127156, 29141848, 29170413, 29171017, 29171785, 29180466, 29180625, 29190822, 29207623, 29207662, 29246182, 29246955, 29280516, 29335520, 29346117, 29358508, 29364480, 29379199, 29407586, 29415999, 29426276, 29427151, 29463565, 29464082, 29467490, 29475959, 29480818, 29514782, 29523126, 29523784, 29555661, 29596783, 29662176, 29682524, 29686284, 29690860, 29721608, 29765548, 29766535, 29854313, 29858716, 29902576, 29936139, 29941481, 29954928, 29968736, 29986909, 30010851, 30015413, 30015867, 3001737, 3006024, 30076412, 30104286, 30135222, 3014513, 3014659, 30205044, 30217192, 30230537, 30237309, 30238564, 30254109, 30254457, 30277098, 30277474, 30285865, 30353671, 30373810, 30389701, 30420657, 30422115, 30459933, 30470303, 30510261, 30553464, 30569626, 30584090, 30606768, 3060795, 30613837, 30666052, 30674894, 30720110, 30725256, 30728358, 30733532, 30746633, 30788663, 30833661, 30836996, 30843188, 30894746, 30898650, 30962504, 30968427, 30968727, 30979864, 31043611, 31090219, 31142360, 31171367, 31186535, 31202256, 31239274, 31239771, 31266538, 31292158, 31319137, 31326549, 31350286, 31361039, 31382461, 31395740, 31447321, 31557193, 31558468, 31570771, 31571905, 31577739, 31582185, 31595558, 31601552, 31606655, 31624110, 31641103, 31662451, 3167852, 31679823, 31685988, 31704724, 31767764, 31790487, 31822509, 31836816, 31848373, 31848709, 3283655, 3327455, 3342413, 3411933, 3529089, 3855502, 6572957, 6603429, 6683594, 7478600, 7531153, 7607564, 7689933, 7812011, 7895514, 7910618, 7913873, 8018954, 8025268, 8043869, 8099529, 8142618, 8249174, 8255093, 8274734, 8297109, 8473043, 8566891, 8608555, 8618233, 8656667, 8891333, 8972757, 8993975, 9071974, 9135021, 9138112, 9177412, 9275322, 9316053, 9331100, 9365240, 9369962, 9395180, 9441131, 9468555, 9482408, 9649157, 9661927, 9674700, 9723034, 9769732, 9927200		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	11559025		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CLINVAR_DG	25157968		★☆☆☆☆ Found in Text Mining only
Neoplasms, Germ Cell and Embryonal	Neoplasm	LHGDN	16423996		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	BEFREE	25739120		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	29739813		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	20651942		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	31357093	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10625678, 12545167, 12769686, 1377938, 15644444, 16822308, 17341633, 17652624, 1776829, 19387923, 19789308, 19946337, 21109931, 21685915, 21856782, 22068108, 22623531, 2302711, 23153536, 23186832, 23280764, 23479628, 23965898, 24173829, 24282277, 2501244, 25186948, 25292042, 25475555, 25880909, 26035700, 26156430, 26373717, 26434591, 2687378, 27012811, 27197232, 27434867, 27448979, 2810395, 28104398, 28270499, 28394338, 28521631, 28684529, 28984200, 29207623, 29207662, 29379199, 29416794, 29426276, 29464082, 2997622, 30153557, 30237861, 31406244, 31441848, 3855502, 7767905, 7913873, 9365240, 9674700		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	Pubtator	12553908, 15382088, 18780787, 20101214, 21109931, 2123747, 22623531, 23091029, 23175188, 23601184, 24173829, 25017515, 25292042, 25896758, 26035700, 26387865, 26537256, 26844271, 27167114, 27919448, 28246384, 28423360, 2869488, 28843484, 28984200, 29426276, 29505958, 30021854, 3006024, 31672841, 32286315, 32409685, 32483461, 32593299, 33016930, 33046535, 34847775, 35008802, 35085004, 36209521, 37116859, 37230388, 37973789, 7767905, 8344386	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	CTD_human_DG	8761367		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	CGI_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	16805856, 22005580, 37796681	Associate	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	11489822, 1377938, 2205380, 27781423, 3837844, 7889335, 9482408		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	BEFREE	2687378, 3837844		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumors	Neuroectodermal Tumors	CTD_human_DG	8761367		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	10963129, 25299775, 29358508		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	10470286, 23437333	Associate	★☆☆☆☆ Found in Text Mining only
Nevus	Nevus	BEFREE	22020039		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	31025872		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	LHGDN	12637527		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	30616142		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	27708232, 30371509		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	29507693		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11578259, 12943625, 1334053, 14570602, 17457227, 21406400, 23239811, 24469837, 25351246, 25748238, 25806711, 26282204, 26295308, 26833129, 27501049, 28076844, 28456659, 28676221, 28714960, 29138830, 29364480, 29744296, 29885057, 30443189, 30867647, 31337706, 31481083, 31496920, 31497362, 31607132, 31828849, 8462246, 8787447, 9468555		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	24688052		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	23062488		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	31657576		★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	31657576	Associate	★☆☆☆☆ Found in Text Mining only
NUT midline carcinoma	Carcinoma	BEFREE	23604113, 27980108, 30696721, 31334571		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	34214899, 36473131	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	27686553		★☆☆☆☆ Found in Text Mining only
Oculodigitoesophagoduodenal syndrome	Feingold syndrome	BEFREE	29636449		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	15656577, 19270750		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	29489901	Associate	★☆☆☆☆ Found in Text Mining only
Opitz GBBB Syndrome, X-Linked	Opitz GBBB Syndrome, X-Linked	BEFREE	31190871		★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	14552656		★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	30254216	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	29806631, 30081074, 32144293, 36619785, 38090564, 38401067, 39738612	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28530641, 28530645		★☆☆☆☆ Found in Text Mining only
Osteopetrosis	Osteopetrosis	BEFREE	9443078		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28530641		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11115584, 18385200, 18981708, 20676132, 21890444, 24942472, 29644114, 30662872, 30902071, 31571905, 8287230		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	18385200, 22037351, 24014087, 24835790, 24942472, 2496060, 25025684, 25546234, 28081736, 28539830, 28924385, 29502343, 29630434, 30902071, 33563042, 33969640, 34335109, 34922636, 35141331, 36717782, 36803784, 36807122, 36996377, 37055822, 37501549, 38031136, 38035708, 40440582	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	CTD_human_DG	24646477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	31397185	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	33125136	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	8972757		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	23006437, 37598177	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15132769, 16458500, 21270607, 27483433, 28739735, 29435159, 30349298, 30422115, 30898650		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16174239		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	20852632		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10549271, 11158614, 12853350, 15132769, 1637683, 17908964, 19147754, 20852632, 2205100, 22951414, 23029531, 23133607, 23919393, 25143136, 26320455, 26516926, 29482638, 29802231, 30058681, 30166592, 30301560, 3032467, 31043753, 31395064, 31540229, 31821542, 31836588, 32046751, 32127525, 32502299, 32553118, 32681706, 32958005, 33069244, 33367952, 34477158, 34510316, 35739532, 36289203, 36552889, 37202753, 37400764, 38003498, 7557622, 7599064, 7962604, 9475195	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	36510984	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11950922, 16423995, 22833572, 25807524, 26108419, 26119937, 27406986, 27721407, 28249168, 28377488, 31311847, 31562613, 31662451		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	11950922, 27406986, 29170413, 30389701, 30423298, 31311847, 31396352		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16874304		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	25961927		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15810077, 16874304, 17496331, 21573184, 22670178, 24392017, 24551298, 25347153, 25807524, 26021472, 26046375, 26108419, 27517489, 27579533, 30932257, 32200350, 32429421, 32456644, 32893006, 32929338, 33099868, 33437202, 33932092, 34031141, 34117747, 34192548, 34958764, 34978469, 35535581, 36068586, 36581205, 36698109, 36757299, 37550432, 37591781, 37831776, 37917550, 38538250, 39376555, 40216980, 9579843	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	Pubtator	32549759, 37063434	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	17496331	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	40216980	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	28538367		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	17409424, 29180625		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28036290, 30391671, 30720110, 7925100		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	10686942, 3064712		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	LHGDN	17145812		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	26070438		★☆☆☆☆ Found in Text Mining only
Paragangliomas 3	Paraganglioma	Pubtator	31996670, 37599362	Associate	★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	Pubtator	15308563	Stimulate	★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	31213128		★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	31213128		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22673189		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34204164	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal nonkinesigenic dyskinesia	Paroxysmal nonkinesigenic dyskinesia	Pubtator	9192778	Associate	★☆☆☆☆ Found in Text Mining only
Partial Trisomy	Trisomy	BEFREE	25677902		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	28720843		★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	34445161	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	36196757	Stimulate	★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	35806108	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28529614		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	26662105	Associate	★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	31171626, 38226984	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	15796198	Associate	★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	22706201, 2405002, 26070438, 9071974, 9177412		★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	8993975		★☆☆☆☆ Found in Text Mining only
pineoblastoma	Pineoblastoma	BEFREE	31820118, 9428362		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	1575012, 28342098		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	35247260, 39290194, 8943742	Associate	★☆☆☆☆ Found in Text Mining only
Pleural Diseases	Pleural diseases	Pubtator	36161776	Associate	★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	29596783		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	29596783		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	18755075	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic kidney disease, type 2	Polycystic kidney disease	CTD_human_DG	25877301		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	8808689		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	CTD_human_DG	25877301		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycystic Kidney, Type 1 Autosomal Dominant Disease	Polycystic kidney disease	CTD_human_DG	25877301		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	18084761		★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	20829716		★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	15098014, 15743832, 1650133, 16527615, 1992441, 20829716, 22779071, 25060305, 26857438, 26962682, 27084248, 28804122, 29022749, 29907650, 3013623, 30991025, 3106693, 3261863, 9402334		★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	18089500, 22779071		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	14576768, 18297523, 21490439, 22563559, 2284100, 22911553, 23673335, 25194570, 27987331, 29407586, 30985716, 7691153		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	18089500		★☆☆☆☆ Found in Text Mining only
Precursor T-cell acute lymphoblastic leukemia	Lymphoblastic Leukemia	Orphanet			★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	17646409, 18765521, 20007543, 20618946, 20924650, 21217079, 21464222, 21527520, 21969595, 22563559, 24249258, 24394663, 25194570, 25270907, 25311243, 26517351, 28115368, 29023469, 29100357, 29743725, 30111845, 30323192, 31266538, 9408752		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	14592832, 18645192, 30306208		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	29407586		★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	BEFREE	16267836, 21748754		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10029066, 10564591, 10754496, 11733359, 12386920, 14522256, 14997205, 15937962, 16267836, 16310933, 17070983, 17319789, 18190704, 18542058, 18567993, 18670647, 19095950, 19549893, 19562729, 19578399, 19773438, 20026909, 20515470, 20627891, 20634801, 20820186, 21685943, 21822302, 21860423, 21941025, 22048240, 22281794, 22585990, 22585994, 23609948, 23720054, 24130167, 24590455, 24783269, 24953652, 25115192, 25201220, 25322691, 25505253, 25770188, 25829425, 25973080, 26279298, 26347108, 26554830, 26799514, 26887047, 26934861, 27159573, 27181203, 27341160, 27550065, 27923366, 27935821, 28139275, 28202510, 28212321, 28412251, 28507054, 28592703, 28653607, 28888037, 29141848, 29358129, 29415999, 29530947, 29665565, 29716963, 29719262, 29720450, 29851094, 29959569, 30086259, 30098506, 30100187, 30280090, 30340213, 30609075, 30733194, 30808975, 30846826, 30863497, 30914434, 31145683, 31554818, 31560094, 31594836, 31704724, 9551622		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	10705309, 16309180, 16827116, 29234244	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	21685943, 26554830, 28414305, 9388062		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10705309, 12000731, 12185081, 14997205, 15314206, 15781629, 16449206, 18350153, 18567993, 18623111, 18670647, 18752058, 19164469, 19276271, 19343732, 19549893, 19562729, 19773438, 20532174, 20634801, 21513580, 21525782, 21748754, 21814516, 21822302, 22128178, 22281794, 22564737, 22585994, 22615405, 22674438, 22791812, 23609948, 23640976, 23704919, 24499724, 24783269, 24948876, 25080090, 25115192, 25149474, 25201220, 25425964, 25512540, 25540201, 25560487, 25869206, 25973080, 26056150, 26279298, 26347108, 26887047, 26934861, 26979803, 27159573, 27341160, 27923366, 28412251, 28463958, 28507054, 28592703, 28692379, 29141848, 29295717, 29415999, 29554906, 29719262, 30009471, 30033370, 30100187, 30339521, 30357756, 30763715, 30846826, 30871495, 30914434, 31066450, 31200842, 31241916, 31735626, 32086391, 32264916, 32343676, 32345668, 32568785, 32651179, 32680982, 32681068, 32763409, 32859160, 33009488, 33115829, 33279858, 33303959, 33586698, 33705753, 33771884, 33852421, 33903734, 33932111, 34573332, 34863188, 34911936, 35239955, 35269731, 35305591, 35317841, 35456461, 35562350, 35776912, 35820087, 35887071, 35943799, 36036607, 36170835, 36293081, 36312753, 36453547, 36752203, 36997534, 37298233, 37301535, 37399401, 37828515, 38166947, 38188680, 39457457, 39741346	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15937962, 17466258, 18190704, 18483343, 18567993, 18623111		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17173048, 23704919, 29295717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18190704, 18542058, 19773438, 20820186, 23348742, 30340213		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18190704, 28592290	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	40362536	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pterygium	Pterygium	BEFREE	22050566		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	36514015	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31829519, 32565880, 32982206, 35438040	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	27366943, 27774982, 3536362, 3803604		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17409424, 21982273, 22155254, 23176581, 24657971, 25964345, 27366943, 28739731, 2914707, 2995998, 31423259, 3536362		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18206534, 18809243, 19061835		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31566109		★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	29327713		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	23197854		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis pigmentosa	Pubtator	23197854, 28677533	Associate	★☆☆☆☆ Found in Text Mining only
RETINITIS PIGMENTOSA 9	Retinitis Pigmentosa	BEFREE	3002438		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	1334491, 1361372, 15354733, 21573126, 22182413, 22222631, 26397460, 27235706, 28165337, 28888422, 29641997		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	LHGDN	17616526		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	28888422, 31184221	Associate	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	21807996, 38100910	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	20212451, 23764045, 31708418, 38040699	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	30230537, 31708418		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor Predisposition Syndrome 1	Rhabdoid tumor predisposition syndrome	Pubtator	34165212	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	16899113, 17081294, 2323837, 28521631, 8943821		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	16899113, 34697065, 35408939, 8471424	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	1462123, 2084514		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15457447		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	34668039	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	12635143, 20949568, 2114387, 22039435, 22383169, 23012233, 24947144, 28521631, 8287230		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	24947144, 25984907, 35069780, 39491746	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	39201282	Inhibit	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	8164678	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	34728235, 37032379, 8952524	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	3078955		★☆☆☆☆ Found in Text Mining only
Sebaceous Gland Neoplasms	Sebaceous gland neoplasms	Pubtator	34445161	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	29579225		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	32615059, 4027160	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	31566109	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29512785, 31566109		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	30068698		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	22384858		★☆☆☆☆ Found in Text Mining only
Shwachman syndrome	Shwachman Syndrome	BEFREE	26762974		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	26046361	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29190822		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	21497295	Associate	★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	32283126	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	9824682	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12466971, 1333951, 16116477, 20615970, 2171744, 22222631, 23035247, 23716474, 24058603, 24596200, 25012251, 2536917, 2540905, 2545636, 25884680, 26253517, 26772203, 27105536, 27373157, 27845189, 28089889, 28192473, 2830010, 2833350, 2842776, 28430666, 28447263, 28490518, 2850489, 28737478, 2995998, 2997622, 30043754, 31164374, 31375684, 31445197, 31598396, 8123593, 8274449, 8390424, 9508209		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12553908, 15665467, 15665468, 1645569, 20615970, 23035247, 23716474, 24058603, 2456019, 25122428, 25495526, 25884680, 26683772, 26772203, 27105536, 28192473, 2850489, 2869482, 3034978, 32901891, 33086069, 33339368, 33514539, 33607458, 34257619, 34396834, 34493659, 35263037, 35583004, 35612556, 36583000, 36715552, 37116859, 37289191, 37907529, 38237798, 9826556	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	2842776	Inhibit	★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	12237776	Associate	★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	26517351, 26916070	Associate	★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	36803548	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	15351094, 23860775		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12820414, 1334053, 1444241, 19673870, 22999547, 23461699, 23521519, 24205356, 27452220, 27845189, 28393404, 28671049, 31114017, 31239771, 8891333, 9786319		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18204787		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12820414, 15774466, 20331630, 22578181, 25919911, 25925090, 26833333, 27721245, 28671049, 29029460, 30050304, 30273571, 31319137, 8142616		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20927317, 21853135, 21998677, 22330139, 2502519, 26506880, 26515287, 28671055, 29385191, 29900911, 30143678, 30341788, 31570856, 32424132, 32716971, 33760210, 33859744, 34958113, 35398964, 35488777, 36012403, 36175504, 36429032, 36999462, 37341071	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27567435	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24501305, 28377632, 29305708		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	21853135		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	19673870, 23521519, 27452220, 29238073, 29796170		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11303627, 12738730, 15225897, 15267185, 16325511, 19453846, 31413594		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	17192869, 25578561, 28393404, 31633227		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	24210820		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	25984907		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	14562369, 17036397, 18932273, 19302034, 20737197, 23717612, 23866769, 23925667, 24053468, 24362523, 24670359, 25047501, 25618371, 26460485, 26514491, 27863420, 28852313, 30396071, 30410872, 31645899, 31701767, 7664243, 9369962, 9809036		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	15188501, 21528007, 22442341, 32102509	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10027304, 10576148, 14562369, 14606069, 15188501, 15526354, 16309200, 16475731, 16609989, 16886612, 17036397, 17431415, 19084934, 19596917, 19697059, 20331625, 20565940, 20658094, 20737197, 20929525, 21042278, 21152119, 21173787, 21528007, 21553350, 22216342, 23714368, 23717612, 24053468, 24917244, 25344918, 25649416, 25743022, 26460485, 26514491, 26940070, 27636990, 27863420, 30206229, 30410872, 30624523, 30679629, 30754645, 30770877, 30828079, 31048690, 31422414, 31454863, 31701767, 31722712, 31733054, 31751609, 31835645, 32292506, 32908912, 33048840, 33111613, 33336736, 33351778, 34042257, 34346836, 34462561, 35073459, 35169855, 35260554, 35545369, 36082059, 36153370, 36201856, 36635500, 37863665, 37993881, 38082402, 39293524	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	17171786, 21173787		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	21538123, 29669762		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	24668547	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29884860		★☆☆☆☆ Found in Text Mining only
Subcutaneous panniculitis-like T-cell lymphoma	Subcutaneous Panniculitis-Like T-Cell Lymphoma	BEFREE	28800143		★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	BEFREE	22805177		★☆☆☆☆ Found in Text Mining only
Sveinsson Chorioretinal Atrophy	Sveinsson chorioretinal atrophy	Pubtator	34493366	Associate	★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	12130502	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	3078955		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	10488335, 15688022, 26988986, 28119527, 9546285		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	LHGDN	18085637		★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	25310835, 7564512, 9614908		★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	12824159	Associate	★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	27503890	Stimulate	★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	18317693, 29761584		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	32615059	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	33311588, 3964537, 4027160	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	18084761, 9406575		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	22505225, 27041560		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	7775120		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	3855302, 9626044	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	28277188, 30531691, 32198408, 34628367, 34723715, 37750019	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	21226903, 22986535, 27960236, 30768848, 9816098		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	30758123	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27440272, 30768848		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28974238, 3005035, 30768848, 32198408, 3348948, 36362068	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	19084934, 2803926	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	28623290	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	30866868		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	27775705		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	18925859, 22430491, 25602521, 26939876, 26950360, 28721678, 28848040, 28951456, 28978427, 29180466, 29260344, 29475913, 30076412, 30324719, 30736840, 30845378, 30854067, 31298382, 31503278, 31577739, 31584090, 31751121, 31836816		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24096545, 25870263, 25953261, 26939876, 26950360, 27208794, 28427212, 28817737, 29475913, 30108112, 30324719, 30704524, 31577739, 31905596, 31942031, 32235890, 32356386, 32873298, 33006750, 34525344, 35087134, 35091678, 35180770, 35382692, 35414060, 35843263, 36774386, 36930677, 37278879, 37570631, 37796506, 38186581, 40037423, 40137853, 40311680	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31836816	Stimulate	★☆☆☆☆ Found in Text Mining only
Trisomy	Trisomy	Pubtator	25270907	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	30237309		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	30237525		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	2228319		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	12237776, 18794855, 19682434, 2125987, 22361733, 23284801, 23624844, 25536625, 26046361, 27456363, 27906180, 28151475, 28720065, 29463565, 30229818, 30668336, 30819803, 30968727, 31223286, 31761897, 33289601, 33723286, 34843906, 35092392, 36316768, 36430344, 37105989, 37433010, 7747807	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urogenital Neoplasms	Urogenital neoplasm	Pubtator	19087307	Associate	★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	10096250, 18628098, 9727623		★☆☆☆☆ Found in Text Mining only
Usher Syndrome Type IG	Usher syndrome	Pubtator	31844144	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	11906549, 1752978, 19373808, 22500694, 24662128, 25596731, 31771040, 7679417	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	15190416		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	12366664, 16378632, 1653781, 1683873, 19596931, 21556123, 22500694, 24662128, 27166252, 27492148, 27835890, 29525942, 29989647, 30018982, 3029760, 31771040, 32271410, 35001007, 39273365, 39327253, 9462237	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27556514	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal melanoma	Pubtator	10209447, 15548813, 19653714, 31848373, 7573354, 7622289	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	26397223		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	19729955, 24039874	Associate	★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	33388092	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	34939316	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	15750208, 26931436	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	30606768		★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	24657971		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	23276184, 28771100		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	28771100	Associate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	BEFREE	12842909		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner Syndrome	LHGDN	12842909		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	12842909	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	30178838	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	8453633		★☆☆☆☆ Found in Text Mining only