Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	394263
Gene name	Mucin 21, cell surface associated
Gene symbol	MUC21
Synonyms (NCBI Gene)	C6orf205KMQK697MUC-21
Chromosome	6
Chromosome location	6p21.33
Summary	This gene encodes a large membrane-bound glycoprotein which is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in in

212 Show/Hide all (212)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050861	hsa-miR-17-5p	CLASH	23622248
MIRT725361	hsa-miR-25-3p	HITS-CLIP	19536157
MIRT725360	hsa-miR-32-5p	HITS-CLIP	19536157
MIRT725359	hsa-miR-363-3p	HITS-CLIP	19536157
MIRT725358	hsa-miR-367-3p	HITS-CLIP	19536157
MIRT725357	hsa-miR-92a-3p	HITS-CLIP	19536157
MIRT725355	hsa-miR-92b-3p	HITS-CLIP	19536157
MIRT725356	hsa-miR-1323	HITS-CLIP	19536157
MIRT725354	hsa-miR-548o-3p	HITS-CLIP	19536157
MIRT725353	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT725352	hsa-miR-548aj-5p	HITS-CLIP	19536157
MIRT725351	hsa-miR-548f-5p	HITS-CLIP	19536157
MIRT725350	hsa-miR-548g-5p	HITS-CLIP	19536157
MIRT725349	hsa-miR-548x-5p	HITS-CLIP	19536157
MIRT725348	hsa-miR-1468-3p	HITS-CLIP	19536157
MIRT725347	hsa-miR-767-5p	HITS-CLIP	19536157
MIRT725346	hsa-miR-548aw	HITS-CLIP	19536157
MIRT725344	hsa-miR-500a-3p	HITS-CLIP	19536157
MIRT725361	hsa-miR-25-3p	HITS-CLIP	19536157
MIRT725360	hsa-miR-32-5p	HITS-CLIP	19536157
MIRT725359	hsa-miR-363-3p	HITS-CLIP	19536157
MIRT725358	hsa-miR-367-3p	HITS-CLIP	19536157
MIRT725357	hsa-miR-92a-3p	HITS-CLIP	19536157
MIRT725355	hsa-miR-92b-3p	HITS-CLIP	19536157
MIRT725356	hsa-miR-1323	HITS-CLIP	19536157
MIRT725354	hsa-miR-548o-3p	HITS-CLIP	19536157
MIRT725353	hsa-miR-1273g-3p	HITS-CLIP	19536157
MIRT725352	hsa-miR-548aj-5p	HITS-CLIP	19536157
MIRT725351	hsa-miR-548f-5p	HITS-CLIP	19536157
MIRT725350	hsa-miR-548g-5p	HITS-CLIP	19536157
MIRT725349	hsa-miR-548x-5p	HITS-CLIP	19536157
MIRT725348	hsa-miR-1468-3p	HITS-CLIP	19536157
MIRT725347	hsa-miR-767-5p	HITS-CLIP	19536157
MIRT725346	hsa-miR-548aw	HITS-CLIP	19536157
MIRT725344	hsa-miR-500a-3p	HITS-CLIP	19536157
MIRT1166295	hsa-miR-1183	CLIP-seq
MIRT1166296	hsa-miR-1225-3p	CLIP-seq
MIRT1166297	hsa-miR-1233	CLIP-seq
MIRT1166298	hsa-miR-1236	CLIP-seq
MIRT1166299	hsa-miR-1254	CLIP-seq
MIRT1166300	hsa-miR-1266	CLIP-seq
MIRT1166301	hsa-miR-1289	CLIP-seq
MIRT1166302	hsa-miR-143	CLIP-seq
MIRT1166303	hsa-miR-1827	CLIP-seq
MIRT1166304	hsa-miR-2114	CLIP-seq
MIRT1166305	hsa-miR-3116	CLIP-seq
MIRT1166306	hsa-miR-3198	CLIP-seq
MIRT1166307	hsa-miR-3200-3p	CLIP-seq
MIRT1166308	hsa-miR-3649	CLIP-seq
MIRT1166309	hsa-miR-3664-3p	CLIP-seq
MIRT1166310	hsa-miR-3690	CLIP-seq
MIRT1166311	hsa-miR-378	CLIP-seq
MIRT1166312	hsa-miR-378b	CLIP-seq
MIRT1166313	hsa-miR-378c	CLIP-seq
MIRT1166314	hsa-miR-378d	CLIP-seq
MIRT1166315	hsa-miR-378e	CLIP-seq
MIRT1166316	hsa-miR-378f	CLIP-seq
MIRT1166317	hsa-miR-378h	CLIP-seq
MIRT1166318	hsa-miR-378i	CLIP-seq
MIRT1166319	hsa-miR-3919	CLIP-seq
MIRT1166320	hsa-miR-3929	CLIP-seq
MIRT1166321	hsa-miR-422a	CLIP-seq
MIRT1166322	hsa-miR-4270	CLIP-seq
MIRT1166323	hsa-miR-4292	CLIP-seq
MIRT1166324	hsa-miR-4294	CLIP-seq
MIRT1166325	hsa-miR-4308	CLIP-seq
MIRT1166326	hsa-miR-4309	CLIP-seq
MIRT1166327	hsa-miR-4419b	CLIP-seq
MIRT1166328	hsa-miR-4433	CLIP-seq
MIRT1166329	hsa-miR-4441	CLIP-seq
MIRT1166330	hsa-miR-4459	CLIP-seq
MIRT1166331	hsa-miR-4478	CLIP-seq
MIRT1166332	hsa-miR-4518	CLIP-seq
MIRT1166333	hsa-miR-4649-3p	CLIP-seq
MIRT1166334	hsa-miR-4695-5p	CLIP-seq
MIRT1166335	hsa-miR-4722-5p	CLIP-seq
MIRT1166336	hsa-miR-4738-3p	CLIP-seq
MIRT1166337	hsa-miR-4768-3p	CLIP-seq
MIRT1166338	hsa-miR-4770	CLIP-seq
MIRT1166339	hsa-miR-485-5p	CLIP-seq
MIRT1166340	hsa-miR-486-3p	CLIP-seq
MIRT1166341	hsa-miR-488	CLIP-seq
MIRT1166342	hsa-miR-510	CLIP-seq
MIRT1166343	hsa-miR-512-5p	CLIP-seq
MIRT1166344	hsa-miR-539	CLIP-seq
MIRT1166345	hsa-miR-548g	CLIP-seq
MIRT1166346	hsa-miR-661	CLIP-seq
MIRT1166347	hsa-miR-670	CLIP-seq
MIRT1166348	hsa-miR-924	CLIP-seq
MIRT1166349	hsa-miR-940	CLIP-seq
MIRT1166295	hsa-miR-1183	CLIP-seq
MIRT2048034	hsa-miR-1228	CLIP-seq
MIRT1166303	hsa-miR-1827	CLIP-seq
MIRT1166304	hsa-miR-2114	CLIP-seq
MIRT2048035	hsa-miR-216a	CLIP-seq
MIRT2048036	hsa-miR-216b	CLIP-seq
MIRT2048037	hsa-miR-24	CLIP-seq
MIRT2048038	hsa-miR-3122	CLIP-seq
MIRT2048039	hsa-miR-342-3p	CLIP-seq
MIRT1166309	hsa-miR-3664-3p	CLIP-seq
MIRT2048040	hsa-miR-3689a-3p	CLIP-seq
MIRT2048041	hsa-miR-3689c	CLIP-seq
MIRT2048042	hsa-miR-3714	CLIP-seq
MIRT2048043	hsa-miR-3913-5p	CLIP-seq
MIRT2048044	hsa-miR-4254	CLIP-seq
MIRT2048045	hsa-miR-4284	CLIP-seq
MIRT2048046	hsa-miR-4310	CLIP-seq
MIRT1166328	hsa-miR-4433	CLIP-seq
MIRT1166330	hsa-miR-4459	CLIP-seq
MIRT1166335	hsa-miR-4722-5p	CLIP-seq
MIRT2048047	hsa-miR-4728-5p	CLIP-seq
MIRT1166336	hsa-miR-4738-3p	CLIP-seq
MIRT1166337	hsa-miR-4768-3p	CLIP-seq
MIRT1166342	hsa-miR-510	CLIP-seq
MIRT1166343	hsa-miR-512-5p	CLIP-seq
MIRT1166345	hsa-miR-548g	CLIP-seq
MIRT2048048	hsa-miR-582-3p	CLIP-seq
MIRT2048049	hsa-miR-765	CLIP-seq
MIRT1166349	hsa-miR-940	CLIP-seq
MIRT1166295	hsa-miR-1183	CLIP-seq
MIRT2048034	hsa-miR-1228	CLIP-seq
MIRT1166303	hsa-miR-1827	CLIP-seq
MIRT1166304	hsa-miR-2114	CLIP-seq
MIRT2048035	hsa-miR-216a	CLIP-seq
MIRT2048036	hsa-miR-216b	CLIP-seq
MIRT2048038	hsa-miR-3122	CLIP-seq
MIRT1166309	hsa-miR-3664-3p	CLIP-seq
MIRT2048040	hsa-miR-3689a-3p	CLIP-seq
MIRT2048041	hsa-miR-3689c	CLIP-seq
MIRT2048042	hsa-miR-3714	CLIP-seq
MIRT2048043	hsa-miR-3913-5p	CLIP-seq
MIRT1166320	hsa-miR-3929	CLIP-seq
MIRT2048046	hsa-miR-4310	CLIP-seq
MIRT1166327	hsa-miR-4419b	CLIP-seq
MIRT1166328	hsa-miR-4433	CLIP-seq
MIRT1166330	hsa-miR-4459	CLIP-seq
MIRT1166331	hsa-miR-4478	CLIP-seq
MIRT1166333	hsa-miR-4649-3p	CLIP-seq
MIRT1166334	hsa-miR-4695-5p	CLIP-seq
MIRT1166335	hsa-miR-4722-5p	CLIP-seq
MIRT2048047	hsa-miR-4728-5p	CLIP-seq
MIRT1166337	hsa-miR-4768-3p	CLIP-seq
MIRT1166339	hsa-miR-485-5p	CLIP-seq
MIRT1166342	hsa-miR-510	CLIP-seq
MIRT1166343	hsa-miR-512-5p	CLIP-seq
MIRT2048049	hsa-miR-765	CLIP-seq
MIRT1166349	hsa-miR-940	CLIP-seq
MIRT1166296	hsa-miR-1225-3p	CLIP-seq
MIRT1166297	hsa-miR-1233	CLIP-seq
MIRT1166303	hsa-miR-1827	CLIP-seq
MIRT1166309	hsa-miR-3664-3p	CLIP-seq
MIRT1166320	hsa-miR-3929	CLIP-seq
MIRT1166327	hsa-miR-4419b	CLIP-seq
MIRT1166328	hsa-miR-4433	CLIP-seq
MIRT1166330	hsa-miR-4459	CLIP-seq
MIRT1166331	hsa-miR-4478	CLIP-seq
MIRT1166333	hsa-miR-4649-3p	CLIP-seq
MIRT1166334	hsa-miR-4695-5p	CLIP-seq
MIRT1166335	hsa-miR-4722-5p	CLIP-seq
MIRT1166337	hsa-miR-4768-3p	CLIP-seq
MIRT1166339	hsa-miR-485-5p	CLIP-seq
MIRT1166342	hsa-miR-510	CLIP-seq
MIRT1166343	hsa-miR-512-5p	CLIP-seq
MIRT1166349	hsa-miR-940	CLIP-seq
MIRT2048034	hsa-miR-1228	CLIP-seq
MIRT2048035	hsa-miR-216a	CLIP-seq
MIRT2048036	hsa-miR-216b	CLIP-seq
MIRT2048038	hsa-miR-3122	CLIP-seq
MIRT2048040	hsa-miR-3689a-3p	CLIP-seq
MIRT2048041	hsa-miR-3689c	CLIP-seq
MIRT2048043	hsa-miR-3913-5p	CLIP-seq
MIRT2048046	hsa-miR-4310	CLIP-seq
MIRT2048047	hsa-miR-4728-5p	CLIP-seq
MIRT2048034	hsa-miR-1228	CLIP-seq
MIRT2048035	hsa-miR-216a	CLIP-seq
MIRT2048036	hsa-miR-216b	CLIP-seq
MIRT2575562	hsa-miR-2909	CLIP-seq
MIRT2048038	hsa-miR-3122	CLIP-seq
MIRT2575563	hsa-miR-34c-3p	CLIP-seq
MIRT2048040	hsa-miR-3689a-3p	CLIP-seq
MIRT2048041	hsa-miR-3689c	CLIP-seq
MIRT2048042	hsa-miR-3714	CLIP-seq
MIRT2048043	hsa-miR-3913-5p	CLIP-seq
MIRT2575564	hsa-miR-4278	CLIP-seq
MIRT2048046	hsa-miR-4310	CLIP-seq
MIRT2575565	hsa-miR-4438	CLIP-seq
MIRT2575566	hsa-miR-4639-3p	CLIP-seq
MIRT2575567	hsa-miR-4687-3p	CLIP-seq
MIRT1166335	hsa-miR-4722-5p	CLIP-seq
MIRT2048047	hsa-miR-4728-5p	CLIP-seq
MIRT2575568	hsa-miR-4777-5p	CLIP-seq
MIRT2575569	hsa-miR-518d-5p	CLIP-seq
MIRT2575570	hsa-miR-519b-5p	CLIP-seq
MIRT2575571	hsa-miR-519c-5p	CLIP-seq
MIRT2575572	hsa-miR-520c-5p	CLIP-seq
MIRT2575573	hsa-miR-526a	CLIP-seq
MIRT1166349	hsa-miR-940	CLIP-seq
MIRT2048034	hsa-miR-1228	CLIP-seq
MIRT2048035	hsa-miR-216a	CLIP-seq
MIRT2048036	hsa-miR-216b	CLIP-seq
MIRT2048038	hsa-miR-3122	CLIP-seq
MIRT2575563	hsa-miR-34c-3p	CLIP-seq
MIRT2048040	hsa-miR-3689a-3p	CLIP-seq
MIRT2048041	hsa-miR-3689c	CLIP-seq
MIRT2048042	hsa-miR-3714	CLIP-seq
MIRT2048043	hsa-miR-3913-5p	CLIP-seq
MIRT2048046	hsa-miR-4310	CLIP-seq
MIRT2575565	hsa-miR-4438	CLIP-seq
MIRT2575566	hsa-miR-4639-3p	CLIP-seq
MIRT1166335	hsa-miR-4722-5p	CLIP-seq
MIRT2048047	hsa-miR-4728-5p	CLIP-seq
MIRT1166349	hsa-miR-940	CLIP-seq

6 Show/Hide all (6)

GO ID	Ontology	Definition	Evidence
GO:0005796	Component	Golgi lumen	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0022408	Process	Negative regulation of cell-cell adhesion	IBA

MIM	HGNC	e!Ensembl
616991	21661	ENSG00000204544

Q5SSG8

Protein name

Mucin-21 (MUC-21) (Epiglycanin)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05647	Epiglycanin_TR	391 → 458	Tandem-repeating region of mucin, epiglycanin-like	Repeat
PF05647	Epiglycanin_TR	76 → 137	Tandem-repeating region of mucin, epiglycanin-like	Repeat
PF05647	Epiglycanin_TR	331 → 393	Tandem-repeating region of mucin, epiglycanin-like	Repeat
PF05647	Epiglycanin_TR	18 → 83	Tandem-repeating region of mucin, epiglycanin-like	Repeat
PF05647	Epiglycanin_TR	167 → 227	Tandem-repeating region of mucin, epiglycanin-like	Repeat
PF05647	Epiglycanin_TR	181 → 239	Tandem-repeating region of mucin, epiglycanin-like	Repeat
PF05647	Epiglycanin_TR	271 → 334	Tandem-repeating region of mucin, epiglycanin-like	Repeat
PF05647	Epiglycanin_TR	123 → 182	Tandem-repeating region of mucin, epiglycanin-like	Repeat
PF05647	Epiglycanin_TR	211 → 274	Tandem-repeating region of mucin, epiglycanin-like	Repeat
PF14654	Epiglycanin_C	463 → 564	Mucin, catalytic, TM and cytoplasmic tail region	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung, large intestine, thymus, and testis. Expressed in normal and malignant bronchial epithelial cells. {ECO:0000269|PubMed:17977904}.

Sequence

MKMQKGNVLLMFGLLLHLEAATNSNETSTSANTGSSVISSGASTATNSGSSVTSSGVSTA
TISGSSVTSNGVSIVTNSEFHTTSSGISTATNSEFSTVSSGISIATNSESSTTSSGASTA
TNSESSTPSSGASTATNSDSSTTSSGASTATNSDSSTTSSEASTATNSESSTTSSGASTA
TNSESSTVSSRASTATNSESSTTSSGASTATNSESRTTSNGAGTATNSESSTTSSGASTA
TNSESSTPSSGAGTATNSESSTTSSGAGTATNSESSTVSSGISTVTNSESSTPSSGANTA
TNSESSTTSSGANTATNSDSSTTSSGASTATNSESSTTSSGASTATNSESSTTSSGASTA
TNSGSSTTSSGTSTATNSESSTVSSGASTATTSESSTTSSGASTATNSESSTVSSGASTA
TNSESSTTSSGANTATNSGSSVTSAGSGTAALTGMHTTSHSASTAVSEAKPGGSLVPWEI
FLITLVSVVAAVGLFAGLFFCVRNSLSLRNTFNTAVYHPHGLNHGLGPGPGGNHGAPHRP
RWSPNWFWRRPVSSIAMEMSGRNSGP

Sequence length

566

Interactions

View interactions

Reactome Pathway
Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
Defective GALNT12 causes colorectal cancer 1 (CRCS1)
Dectin-2 family
O-linked glycosylation of mucins
Termination of O-glycan biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (24)
ASTHMA	—	GWAS catalog	31669095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	28540026	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	38154582	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	31669095	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLONAL HEMATOPOIESIS	—	GWAS catalog	39948438	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS LUPUS ERYTHEMATOSUS	—	GWAS catalog	25827949	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	39192244	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL APOLIPOPROTEIN B HYPOBETALIPOPROTEINEMIA	—	GWAS catalog	36168886	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29662059, 30626913, 30718454	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUC21-related disorder	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	32276964	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	23551011	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	28540026	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	28604730	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	26502338, 33272962	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	38154582	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	33667223	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (18)
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30329165, 30964151, 30973916, 31301084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22611128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30626913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	30626913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	30626913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	37062177	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37858248	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASDB_DG	24871463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30626913		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	30626913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	30329165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	GWASDB_DG	23055271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30973916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30626913		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	22611128		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33315534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	36930113	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PRUNE2	3	["Cervical cancer","Dental caries","Upper aerodigestive tract neoplasm"]	0	[]	3	["GWAS catalog (Cervical cancer)","GWAS catalog (Dental caries)","GWAS catalog (Upper aerodigestive tract neoplasm)"]
LZTS1	3	["Cervical cancer","Dental caries","Preeclampsia"]	0	[]	3	["GWAS catalog (Cervical cancer)","GWAS catalog (Dental caries)","GWAS catalog (Preeclampsia)"]
MUC12	0	[]	6	["O-linked glycosylation of mucins","Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)","Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)","Defective GALNT12 causes colorectal cancer 1 (CRCS1)","Dectin-2 family","Termination of O-glycan biosynthesis"]	0	[]
MUCL1	0	[]	6	["O-linked glycosylation of mucins","Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)","Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)","Defective GALNT12 causes colorectal cancer 1 (CRCS1)","Dectin-2 family","Termination of O-glycan biosynthesis"]	0	[]
MUC17	0	[]	6	["O-linked glycosylation of mucins","Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)","Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)","Defective GALNT12 causes colorectal cancer 1 (CRCS1)","Dectin-2 family","Termination of O-glycan biosynthesis"]	0	[]

MUC21 (mucin 21, cell surface associated)

Bookmark This Gene