MTLN (mitoregulin)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Diseases linked via similar genes

Gene

• Entrez ID: 205251
• Gene name: Mitoregulin
• Gene symbol: MTLN
• Synonyms (NCBI Gene): LEMP, LINC00116, MOXI, MPM, NCRNA00116, SMIM37, TILR
• Chromosome: 2
• Chromosome location: 2q13

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32243843
GO:0005739	Component	Mitochondrion	IDA	32243843
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005743	Component	Mitochondrial inner membrane	IBA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	ISS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	ISS
GO:0006635	Process	Fatty acid beta-oxidation	IMP	32243843
GO:0010918	Process	Positive regulation of mitochondrial membrane potential	IBA
GO:0010918	Process	Positive regulation of mitochondrial membrane potential	IDA	29949756
GO:0016020	Component	Membrane	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	ISS
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	IEA
GO:0032000	Process	Positive regulation of fatty acid beta-oxidation	ISS
GO:0045333	Process	Cellular respiration	IEA
GO:0045333	Process	Cellular respiration	ISS
GO:0051146	Process	Striated muscle cell differentiation	IEA
GO:0051146	Process	Striated muscle cell differentiation	ISS
GO:0051284	Process	Positive regulation of sequestering of calcium ion	IBA
GO:0051284	Process	Positive regulation of sequestering of calcium ion	IDA	29949756
GO:0051284	Process	Positive regulation of sequestering of calcium ion	IEA
GO:0070328	Process	Triglyceride homeostasis	IMP	32243843

Other IDs

• MIM: 620770
• HGNC: 27339
• e!Ensembl: ENSG00000175701

Protein

• UniProt ID: Q8NCU8
• Protein name: Mitoregulin (Micropeptide in mitochondria) (Micropeptide regulator of beta-oxidation) (Small integral membrane protein 37) (lncRNA-encoded micropeptide)
• Protein function: Positively regulates mitochondrial complex assembly and/or stability (By similarity). Increases mitochondrial membrane potential while decreasing mitochondrial reactive oxygen species (PubMed:29949756). Increases mitochondrial respiration rate (
• Sequence:

  MADVSERTLQLSVLVAFASGVLLGWQANRLRRRYLDWRKRRLQDKLAATQKKLDLA

• Sequence length: 56

Related Genes

No strongly related genes found yet for MTLN.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MTLN.