MTFP1 (mitochondrial fission process 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51537
• Gene name: Mitochondrial fission process 1
• Gene symbol: MTFP1
• Synonyms (NCBI Gene): HSPC242, MTP18
• Chromosome: 22
• Chromosome location: 22q12.2
• Summary: MTP18 is a mitochondrial protein and downstream target of the phosphatidylinositol 3-kinase (see PIK3CA, MIM 171834) signaling pathway that plays a role in cell viability and mitochondrial dynamics (Tondera et al., 2004 [PubMed 15155745]).[supplied by OMI

miRNA Show/Hide all (30)

miRTarBase ID	miRNA	Experiments	Reference
MIRT032340	hsa-let-7b-5p	Proteomics	18668040
MIRT049599	hsa-miR-92a-3p	CLASH	23622248
MIRT043820	hsa-miR-328-3p	CLASH	23622248
MIRT041093	hsa-miR-504-5p	CLASH	23622248
MIRT1163077	hsa-miR-1231	CLIP-seq
MIRT1163078	hsa-miR-125a-5p	CLIP-seq
MIRT1163079	hsa-miR-125b	CLIP-seq
MIRT1163080	hsa-miR-219-1-3p	CLIP-seq
MIRT1163081	hsa-miR-346	CLIP-seq
MIRT1163082	hsa-miR-4287	CLIP-seq
MIRT1163083	hsa-miR-4288	CLIP-seq
MIRT1163084	hsa-miR-4319	CLIP-seq
MIRT1163085	hsa-miR-4469	CLIP-seq
MIRT1163086	hsa-miR-4682	CLIP-seq
MIRT1163087	hsa-miR-4685-3p	CLIP-seq
MIRT1163088	hsa-miR-4713-5p	CLIP-seq
MIRT1163089	hsa-miR-4732-3p	CLIP-seq
MIRT1163090	hsa-miR-571	CLIP-seq
MIRT1163091	hsa-miR-632	CLIP-seq
MIRT1163092	hsa-miR-670	CLIP-seq
MIRT2574857	hsa-miR-1184	CLIP-seq
MIRT2574858	hsa-miR-4252	CLIP-seq
MIRT2574859	hsa-miR-4635	CLIP-seq
MIRT2574860	hsa-miR-4691-3p	CLIP-seq
MIRT2574861	hsa-miR-526b	CLIP-seq
MIRT2574857	hsa-miR-1184	CLIP-seq
MIRT2574858	hsa-miR-4252	CLIP-seq
MIRT2574859	hsa-miR-4635	CLIP-seq
MIRT2574860	hsa-miR-4691-3p	CLIP-seq
MIRT2574861	hsa-miR-526b	CLIP-seq

Gene ontology (GO) Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000266	Process	Mitochondrial fission	IBA
GO:0000266	Process	Mitochondrial fission	IMP	15985469
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	15985469
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 610235
• HGNC: 26945
• e!Ensembl: ENSG00000242114

Protein

• UniProt ID: Q9UDX5
• Protein name: Mitochondrial fission process protein 1 (Mitochondrial 18 kDa protein) (MTP18)
• Protein function: Involved in the mitochondrial division probably by regulating membrane fission. Loss-of-function induces the release of cytochrome c, which activates the caspase cascade and leads to apoptosis. {ECO:0000269|PubMed:15155745, ECO:0000269|PubMed:15
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10558	MTP18	62 → 149	Mitochondrial 18 KDa protein (MTP18)	Family
  PF10558	MTP18	13 → 72	Mitochondrial 18 KDa protein (MTP18)	Family

• Sequence:

  MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKG
  KKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLA
  VRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS

• Sequence length: 166

Related Genes

No strongly related genes found yet for MTFP1.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MTFP1.