MTERF3 (mitochondrial transcription termination factor 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51001
• Gene name: Mitochondrial transcription termination factor 3
• Gene symbol: MTERF3
• Synonyms (NCBI Gene): CGI-12, MTERFD1
• Chromosome: 8
• Chromosome location: 8q22.1

Gene ontology (GO) Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	17662942
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	17662942
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005759	Component	Mitochondrial matrix	IDA	27974379
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	17662942
GO:0061668	Process	Mitochondrial ribosome assembly	IBA
GO:1903108	Process	Regulation of mitochondrial transcription	IBA

Other IDs

• MIM: 616930
• HGNC: 24258
• e!Ensembl: ENSG00000156469

Protein

• UniProt ID: Q96E29
• Protein name: Transcription termination factor 3, mitochondrial (Mitochondrial transcription termination factor 3) (mTERF3) (mTERF domain-containing protein 1, mitochondrial)
• Protein function: Binds promoter DNA and regulates initiation of transcription (PubMed:17662942). Required for normal mitochondrial transcription and translation, and for normal assembly of mitochondrial respiratory complexes. Required for normal mitochondrial fu
• PDB: 3M66
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02536	mTERF	125 → 399	mTERF	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in heart, liver, kidney and testis. Detected at lower levels in brain, spleen and lung. {ECO:0000269|PubMed:17662942}.
• Sequence:

  MALSAQQIPRWFNSVKLRSLINAAQLTKRFTRPARTLLHGFSAQPQISSDNCFLQWGFKT
  YRTSSLWNSSQSTSSSSQENNSAQSSLLPSMNEQSQKTQNISSFDSELFLEELDELPPLS
  PMQPISEEEAIQIIADPPLPPASFTLRDYVDHSETLQKLVLLGVDLSKIEKHPEAANLLL
  RLDFEKDIKQMLLFLKDVGIEDNQLGAFLTKNHAIFSEDLENLKTRVAYLHSKNFSKADV
  AQMVRKAPFLLNFSVERLDNRLGFFQKELELSVKKTRDLVVRLPRLLTGSLEPVKENMKV
  YRLELGFKHNEIQHMITRIPKMLTANKMKLTETFDFVHNVMSIPHHIIVKFPQVFNTRLF
  KVKERHLFLTYLGRAQYDPAKPNYISLDKLVSIPDEIFCEEIAKASVQDFEKFLKTL

• Sequence length: 417

Pathways

Reactome Pathway:

Pink/Parkin Mediated Mitophagy

Related Genes

No strongly related genes found yet for MTERF3.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MTERF3.