MTERF2 (mitochondrial transcription termination factor 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 80298
Gene name Mitochondrial transcription termination factor 2
Gene symbol MTERF2
Synonyms (NCBI Gene)
MTERFD3mTERFL
Chromosome 12
Chromosome location 12q23.3
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003676 Function Nucleic acid binding IBA
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IDA 19366608
GO:0005515 Function Protein binding IPI 32296183
GO:0005739 Component Mitochondrion HTP 34800366
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
616929 30779 ENSG00000120832
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q49AM1
Protein name Transcription termination factor 2, mitochondrial (Mitochondrial transcription termination factor 2) (mTERF2) (Mitochondrial transcription termination factor-like protein) (mTERF-like) (mTERFL) (mTERF domain-containing protein 3, mitochondrial)
Protein function Binds mitochondrial DNA and plays a role in the regulation of transcription of mitochondrial mRNA and rRNA species.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02536 mTERF 49 → 360 mTERF Family
Tissue specificity TISSUE SPECIFICITY: Expressed in skeletal muscle, heart, liver and pancreas. {ECO:0000269|PubMed:16226716}.
Sequence 
MLWKLLLRSQSCRLCSFRKMRSPPKYRPFLACFTYTTDKQSSKENTRTVEKLYKCSVDIR
KIRRLKGWVLLEDETYVEEIANILQELGADETAVASILERCPEAIVCSPTAVNTQRKLWQ
LVCKNEEELIKLIEQFPESFFTIKDQENQKLNVQFFQELGLKNVVISRLLTAAPNVFHNP
VEKNKQMVRILQESYLDVGGSEANMKVWLLKLLSQNPFILLNSPTAIKETLEFLQEQGFT
SFEILQLLSKLKGFLFQLCPRSIQNSISFSKNAFKCTDHDLKQLVLKCPALLYYSVPVLE
ERMQGLLREGISIAQIRETPMVLELTPQIVQYRIRKLNSSGYRIKDGHLANLNGSKKEFE
ANFGKIQAKKVRPLFNPVAPLNVEE
Sequence length 385
Interactions View interactions

No strongly related genes found yet for MTERF2.

No additional diseases found yet through genes similar to MTERF2.