MT1X (metallothionein 1X)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Diseases linked via similar genes

Gene

• Entrez ID: 4501
• Gene name: Metallothionein 1X
• Gene symbol: MT1X
• Synonyms (NCBI Gene): MT-1l, MT1
• Chromosome: 16
• Chromosome location: 16q13

miRNA Show/Hide all (24)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026466	hsa-miR-192-5p	Microarray	19074876
MIRT054330	hsa-miR-1225-3p	Microarray, qRT-PCR	23593351
MIRT1162134	hsa-miR-137	CLIP-seq
MIRT1162135	hsa-miR-23a	CLIP-seq
MIRT1162136	hsa-miR-23b	CLIP-seq
MIRT1162137	hsa-miR-23c	CLIP-seq
MIRT1162138	hsa-miR-376a	CLIP-seq
MIRT1162139	hsa-miR-376b	CLIP-seq
MIRT1162140	hsa-miR-4659a-5p	CLIP-seq
MIRT1162141	hsa-miR-4659b-5p	CLIP-seq
MIRT1162142	hsa-miR-4776-3p	CLIP-seq
MIRT1162143	hsa-miR-4777-5p	CLIP-seq
MIRT2431274	hsa-miR-296-3p	CLIP-seq
MIRT2431275	hsa-miR-3613-3p	CLIP-seq
MIRT2431276	hsa-miR-3613-5p	CLIP-seq
MIRT2431274	hsa-miR-296-3p	CLIP-seq
MIRT2431275	hsa-miR-3613-3p	CLIP-seq
MIRT2431276	hsa-miR-3613-5p	CLIP-seq
MIRT2431274	hsa-miR-296-3p	CLIP-seq
MIRT2431275	hsa-miR-3613-3p	CLIP-seq
MIRT2431276	hsa-miR-3613-5p	CLIP-seq
MIRT2431274	hsa-miR-296-3p	CLIP-seq
MIRT2431275	hsa-miR-3613-3p	CLIP-seq
MIRT2431276	hsa-miR-3613-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21044950, 23251525, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	8619255
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	8619255
GO:0006882	Process	Intracellular zinc ion homeostasis	IBA
GO:0008270	Function	Zinc ion binding	ISS
GO:0010038	Process	Response to metal ion	TAS	9074634
GO:0010273	Process	Detoxification of copper ion	IBA
GO:0036018	Process	Cellular response to erythropoietin	IEP	11168427
GO:0045926	Process	Negative regulation of growth	ISS
GO:0046872	Function	Metal ion binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0046872	Function	Metal ion binding	TAS	9074634
GO:0071276	Process	Cellular response to cadmium ion	IBA
GO:0071276	Process	Cellular response to cadmium ion	IEP	16827180
GO:0071280	Process	Cellular response to copper ion	IBA
GO:0071294	Process	Cellular response to zinc ion	IBA
GO:0071294	Process	Cellular response to zinc ion	IEP	11168427

Other IDs

• MIM: 156359
• HGNC: 7405
• e!Ensembl: ENSG00000187193

Protein

• UniProt ID: P80297
• Protein name: Metallothionein-1X (MT-1X) (Metallothionein-IX) (MT-IX)
• Protein function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. May be involved in FAM168A anti-apoptotic signaling (PubMed:232515
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00131	Metallothio	1 → 61	Metallothionein	Domain

• Sequence:

  MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSCC
  A

• Sequence length: 61

Pathways

KEGG Pathway:

Mineral absorption

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
MT1X-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (62)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	36035305	Associate	★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	11298796		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	21480980		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	30932010	Stimulate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11270423		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18979234, 19522736, 20050373, 23330677, 31092851, 31290783, 9694254		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36149322	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33215860, 34257549, 34663301	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	11270423		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	12616185		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25174824, 27840927		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36149322	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29269399		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	1584781		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22108904		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31394742, 34024817	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16249430, 31624901		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	35741790	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36466860, 37091857	Associate	★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	31092851		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	12215093		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	12215093, 15354075, 16280977, 18591929		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30932010	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29408377		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	30932010	Stimulate	★☆☆☆☆ Found in Text Mining only
Grade I Astrocytoma	Grade I Astrocytoma	BEFREE	30932010		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	22090273, 30504400		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	24892424	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	24892424		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	9694254		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21994366		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36149322	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	28796402		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30098078		★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	12616185		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35316152	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21718361, 25247452, 29873415, 30504401		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27840927	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18601746		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	18601746		★☆☆☆☆ Found in Text Mining only
Lymphoma, Diffuse	Lymphoma	BEFREE	16322236		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18979234, 19522736, 20050373, 23330677, 31092851, 9694254		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	12616185		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25174824, 27840927		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10754528, 22856547		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	11270423		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29854276		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11888668, 18979234, 30360728		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11270423, 18979234, 23073719, 29408377, 29873415		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	18601746		★☆☆☆☆ Found in Text Mining only
Nodular Goiter	Nodular Goiter	BEFREE	28870952, 30504400		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23064051, 27840927		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17660800, 28870952		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	31540037	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10754528, 22856547		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	18992145	Associate	★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	36050999, 36147639	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23251525		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23251525	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	17660800	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	22090273		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28388658	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for MT1X.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MT1X.