MT1HL1 (metallothionein 1H like 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 645745
Gene name Metallothionein 1H like 1
Gene symbol MT1HL1
Synonyms (NCBI Gene)
MT1P2
Chromosome 1
Chromosome location 1q43
Summary This gene is a retrotransposed gene, compared to MT1H (GeneID:4496). This retrogene is transcribed. It retains a full-length CDS, and is assumed to be translated. Compared to the MT1H product, this protein product differs at three internal amino acids, tw
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT029597 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9 Show/Hide all (9)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IBA
GO:0006882 Process Intracellular zinc ion homeostasis IBA
GO:0010273 Process Detoxification of copper ion IBA
GO:0046872 Function Metal ion binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P0DM35
Protein name Metallothionein 1H-like protein 1
Protein function Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00131 Metallothio 1 → 61 Metallothionein Domain
Sequence 
MDPNCSCAAGGSYACAGSCKCKKCKCTSCKKSCCSCCPLGCAKCAQGCIRKGASEKCSCC
A
Sequence length 61
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Mineral absorption

No strongly related genes found yet for MT1HL1.

No additional diseases found yet through genes similar to MT1HL1.