MT1DP (metallothionein 1D, pseudogene)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 326343
Gene name Metallothionein 1D, pseudogene
Gene symbol MT1DP
Synonyms (NCBI Gene)
MTM
Chromosome 16
Chromosome location 16q13
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10 Show/Hide all (10)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956
GO:0005634 Component Nucleus IBA
GO:0005737 Component Cytoplasm IBA
GO:0006882 Process Intracellular zinc ion homeostasis IBA
GO:0010273 Process Detoxification of copper ion IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC 7396 N/A
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A1L3X4
Protein name Putative metallothionein MT1DP
Protein function Metallothioneins have a high content of cysteine residues that bind various heavy metals.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00131 Metallothio 1 → 49 Metallothionein Domain
Sequence 
MDLSCSCATGGSCTCASSCKCKEYKCTSCKKNCCSCCPMGCAKCAQGCT
Sequence length 49
Interactions View interactions

No strongly related genes found yet for MT1DP.

No additional diseases found yet through genes similar to MT1DP.