MSMP (microseminoprotein, prostate associated)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Related genes Diseases linked via similar genes

Gene

• Entrez ID: 692094
• Gene name: Microseminoprotein, prostate associated
• Gene symbol: MSMP
• Synonyms (NCBI Gene): PSMP
• Chromosome: 9
• Chromosome location: 9p13.3
• Summary: This gene encodes a member of the beta-microseminoprotein family. Members of this protein family contain ten conserved cysteine residues that form intra-molecular disulfide bonds. The encoded protein may play a role in prostate cancer tumorigenesis. [prov

miRNA Show/Hide all (17)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1161730	hsa-miR-15a	CLIP-seq
MIRT1161731	hsa-miR-15b	CLIP-seq
MIRT1161732	hsa-miR-16	CLIP-seq
MIRT1161733	hsa-miR-195	CLIP-seq
MIRT1161734	hsa-miR-214	CLIP-seq
MIRT1161735	hsa-miR-3619-5p	CLIP-seq
MIRT1161736	hsa-miR-375	CLIP-seq
MIRT1161737	hsa-miR-424	CLIP-seq
MIRT1161738	hsa-miR-4274	CLIP-seq
MIRT1161739	hsa-miR-4291	CLIP-seq
MIRT1161740	hsa-miR-4468	CLIP-seq
MIRT1161741	hsa-miR-4519	CLIP-seq
MIRT1161742	hsa-miR-4775	CLIP-seq
MIRT1161743	hsa-miR-497	CLIP-seq
MIRT1161744	hsa-miR-761	CLIP-seq
MIRT1161745	hsa-miR-885-3p	CLIP-seq
MIRT1161746	hsa-miR-922	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002548	Process	Monocyte chemotaxis	IDA	24442440
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	17338636, 24442440
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17338636
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0031727	Function	CCR2 chemokine receptor binding	IDA	24442440
GO:0048247	Process	Lymphocyte chemotaxis	IDA	24442440

Other IDs

• MIM: 612191
• HGNC: 29663
• e!Ensembl: ENSG00000215183

Protein

• UniProt ID: Q1L6U9
• Protein name: Prostate-associated microseminoprotein (PC3-secreted microprotein)
• Protein function: Acts as a ligand for C-C chemokine receptor CCR2 (PubMed:24442440). Signals through binding and activation of CCR2 and induces a strong chemotactic response and mobilization of intracellular calcium ions (PubMed:24442440). Exhibits a chemotactic
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05825	PSP94	37 → 118	Beta-microseminoprotein (PSP-94)	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in prostate epithelium (at protein level) (PubMed:17338636). Detected in trachea and testis (PubMed:17338636). Highly expressed in benign prostatic hyperplasia and in some prostate cancers, and can also be detected in breast t
• Sequence:

  MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWL
  RKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPD
  PEWGSANTPVPGAPAPHSS

• Sequence length: 139

Related Genes

No strongly related genes found yet for MSMP.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to MSMP.