MS4A8 (membrane spanning 4-domains A8)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 83661
Gene name Membrane spanning 4-domains A8
Gene symbol MS4A8
Synonyms (NCBI Gene)
4SPAN4CD20L5MS4A4MS4A8B
Chromosome 11
Chromosome location 11q12.2
Summary This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells a
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018776 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IBA
GO:0005886 Component Plasma membrane IDA 23874341
GO:0007166 Process Cell surface receptor signaling pathway IBA
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
606549 13380 ENSG00000166959
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BY19
Protein name Membrane-spanning 4-domains subfamily A member 8 (Four-span transmembrane protein 4) (Membrane-spanning 4-domains subfamily A member 8B)
Protein function May be involved in signal transduction as a component of a multimeric receptor complex.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04103 CD20 71 → 172 CD20-like family Family
Tissue specificity TISSUE SPECIFICITY: Expressed by hematopoietic tissues and cells lines.
Sequence 
MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQ
PVQKALKEGKTLGAIQIIIGLAHIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGS
LSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNP
GMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPP
SYSSEIQANK
Sequence length 250
Interactions View interactions

No strongly related genes found yet for MS4A8.

No additional diseases found yet through genes similar to MS4A8.