MRPS5 (mitochondrial ribosomal protein S5)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 64969
• Gene name: Mitochondrial ribosomal protein S5
• Gene symbol: MRPS5
• Synonyms (NCBI Gene): MRP-S5, S5mt, uS5m
• Chromosome: 2
• Chromosome location: 2q11.1
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

miRNA Show/Hide all (123)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028578	hsa-miR-30a-5p	Proteomics	18668040
MIRT044605	hsa-miR-320a	CLASH	23622248
MIRT447533	hsa-miR-548a-5p	PAR-CLIP	22100165
MIRT447532	hsa-miR-548ab	PAR-CLIP	22100165
MIRT447531	hsa-miR-548ad-5p	PAR-CLIP	22100165
MIRT447530	hsa-miR-548ae-5p	PAR-CLIP	22100165
MIRT447529	hsa-miR-548ak	PAR-CLIP	22100165
MIRT447528	hsa-miR-548am-5p	PAR-CLIP	22100165
MIRT447527	hsa-miR-548ap-5p	PAR-CLIP	22100165
MIRT447526	hsa-miR-548aq-5p	PAR-CLIP	22100165
MIRT447525	hsa-miR-548ar-5p	PAR-CLIP	22100165
MIRT447524	hsa-miR-548as-5p	PAR-CLIP	22100165
MIRT447523	hsa-miR-548au-5p	PAR-CLIP	22100165
MIRT447522	hsa-miR-548ay-5p	PAR-CLIP	22100165
MIRT447521	hsa-miR-548b-5p	PAR-CLIP	22100165
MIRT447520	hsa-miR-548bb-5p	PAR-CLIP	22100165
MIRT447519	hsa-miR-548c-5p	PAR-CLIP	22100165
MIRT447518	hsa-miR-548d-5p	PAR-CLIP	22100165
MIRT447517	hsa-miR-548h-5p	PAR-CLIP	22100165
MIRT447516	hsa-miR-548i	PAR-CLIP	22100165
MIRT447515	hsa-miR-548j-5p	PAR-CLIP	22100165
MIRT447514	hsa-miR-548o-5p	PAR-CLIP	22100165
MIRT447512	hsa-miR-548w	PAR-CLIP	22100165
MIRT447513	hsa-miR-548y	PAR-CLIP	22100165
MIRT447511	hsa-miR-559	PAR-CLIP	22100165
MIRT447510	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT447509	hsa-miR-548k	PAR-CLIP	22100165
MIRT447508	hsa-miR-8054	PAR-CLIP	22100165
MIRT447507	hsa-miR-548l	PAR-CLIP	22100165
MIRT447506	hsa-miR-4635	PAR-CLIP	22100165
MIRT447505	hsa-miR-7158-3p	PAR-CLIP	22100165
MIRT447504	hsa-miR-203b-3p	PAR-CLIP	22100165
MIRT447533	hsa-miR-548a-5p	PAR-CLIP	22100165
MIRT447532	hsa-miR-548ab	PAR-CLIP	22100165
MIRT447531	hsa-miR-548ad-5p	PAR-CLIP	22100165
MIRT447530	hsa-miR-548ae-5p	PAR-CLIP	22100165
MIRT447529	hsa-miR-548ak	PAR-CLIP	22100165
MIRT447528	hsa-miR-548am-5p	PAR-CLIP	22100165
MIRT447527	hsa-miR-548ap-5p	PAR-CLIP	22100165
MIRT447526	hsa-miR-548aq-5p	PAR-CLIP	22100165
MIRT447525	hsa-miR-548ar-5p	PAR-CLIP	22100165
MIRT447524	hsa-miR-548as-5p	PAR-CLIP	22100165
MIRT447523	hsa-miR-548au-5p	PAR-CLIP	22100165
MIRT447522	hsa-miR-548ay-5p	PAR-CLIP	22100165
MIRT447521	hsa-miR-548b-5p	PAR-CLIP	22100165
MIRT447520	hsa-miR-548bb-5p	PAR-CLIP	22100165
MIRT447519	hsa-miR-548c-5p	PAR-CLIP	22100165
MIRT447518	hsa-miR-548d-5p	PAR-CLIP	22100165
MIRT447517	hsa-miR-548h-5p	PAR-CLIP	22100165
MIRT447516	hsa-miR-548i	PAR-CLIP	22100165
MIRT447515	hsa-miR-548j-5p	PAR-CLIP	22100165
MIRT447514	hsa-miR-548o-5p	PAR-CLIP	22100165
MIRT447512	hsa-miR-548w	PAR-CLIP	22100165
MIRT447513	hsa-miR-548y	PAR-CLIP	22100165
MIRT447511	hsa-miR-559	PAR-CLIP	22100165
MIRT447510	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT447509	hsa-miR-548k	PAR-CLIP	22100165
MIRT447508	hsa-miR-8054	PAR-CLIP	22100165
MIRT447507	hsa-miR-548l	PAR-CLIP	22100165
MIRT447506	hsa-miR-4635	PAR-CLIP	22100165
MIRT447505	hsa-miR-7158-3p	PAR-CLIP	22100165
MIRT447504	hsa-miR-203b-3p	PAR-CLIP	22100165
MIRT733230	hsa-miR-135a-5p	RNA-seq	33674273
MIRT447533	hsa-miR-548a-5p	PAR-CLIP	22100165
MIRT447532	hsa-miR-548ab	PAR-CLIP	22100165
MIRT447531	hsa-miR-548ad-5p	PAR-CLIP	22100165
MIRT447530	hsa-miR-548ae-5p	PAR-CLIP	22100165
MIRT447529	hsa-miR-548ak	PAR-CLIP	22100165
MIRT447528	hsa-miR-548am-5p	PAR-CLIP	22100165
MIRT447527	hsa-miR-548ap-5p	PAR-CLIP	22100165
MIRT447526	hsa-miR-548aq-5p	PAR-CLIP	22100165
MIRT447525	hsa-miR-548ar-5p	PAR-CLIP	22100165
MIRT447524	hsa-miR-548as-5p	PAR-CLIP	22100165
MIRT447523	hsa-miR-548au-5p	PAR-CLIP	22100165
MIRT447522	hsa-miR-548ay-5p	PAR-CLIP	22100165
MIRT447521	hsa-miR-548b-5p	PAR-CLIP	22100165
MIRT447520	hsa-miR-548bb-5p	PAR-CLIP	22100165
MIRT447519	hsa-miR-548c-5p	PAR-CLIP	22100165
MIRT447518	hsa-miR-548d-5p	PAR-CLIP	22100165
MIRT447517	hsa-miR-548h-5p	PAR-CLIP	22100165
MIRT447516	hsa-miR-548i	PAR-CLIP	22100165
MIRT447515	hsa-miR-548j-5p	PAR-CLIP	22100165
MIRT447514	hsa-miR-548o-5p	PAR-CLIP	22100165
MIRT447512	hsa-miR-548w	PAR-CLIP	22100165
MIRT447513	hsa-miR-548y	PAR-CLIP	22100165
MIRT447511	hsa-miR-559	PAR-CLIP	22100165
MIRT447510	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT447509	hsa-miR-548k	PAR-CLIP	22100165
MIRT447508	hsa-miR-8054	PAR-CLIP	22100165
MIRT447507	hsa-miR-548l	PAR-CLIP	22100165
MIRT447506	hsa-miR-4635	PAR-CLIP	22100165
MIRT447505	hsa-miR-7158-3p	PAR-CLIP	22100165
MIRT447504	hsa-miR-203b-3p	PAR-CLIP	22100165
MIRT447533	hsa-miR-548a-5p	PAR-CLIP	22100165
MIRT447532	hsa-miR-548ab	PAR-CLIP	22100165
MIRT447531	hsa-miR-548ad-5p	PAR-CLIP	22100165
MIRT447530	hsa-miR-548ae-5p	PAR-CLIP	22100165
MIRT447529	hsa-miR-548ak	PAR-CLIP	22100165
MIRT447528	hsa-miR-548am-5p	PAR-CLIP	22100165
MIRT447527	hsa-miR-548ap-5p	PAR-CLIP	22100165
MIRT447526	hsa-miR-548aq-5p	PAR-CLIP	22100165
MIRT447525	hsa-miR-548ar-5p	PAR-CLIP	22100165
MIRT447524	hsa-miR-548as-5p	PAR-CLIP	22100165
MIRT447523	hsa-miR-548au-5p	PAR-CLIP	22100165
MIRT447522	hsa-miR-548ay-5p	PAR-CLIP	22100165
MIRT447521	hsa-miR-548b-5p	PAR-CLIP	22100165
MIRT447520	hsa-miR-548bb-5p	PAR-CLIP	22100165
MIRT447519	hsa-miR-548c-5p	PAR-CLIP	22100165
MIRT447518	hsa-miR-548d-5p	PAR-CLIP	22100165
MIRT447517	hsa-miR-548h-5p	PAR-CLIP	22100165
MIRT447516	hsa-miR-548i	PAR-CLIP	22100165
MIRT447515	hsa-miR-548j-5p	PAR-CLIP	22100165
MIRT447514	hsa-miR-548o-5p	PAR-CLIP	22100165
MIRT447512	hsa-miR-548w	PAR-CLIP	22100165
MIRT447513	hsa-miR-548y	PAR-CLIP	22100165
MIRT447511	hsa-miR-559	PAR-CLIP	22100165
MIRT447510	hsa-miR-548av-5p	PAR-CLIP	22100165
MIRT447509	hsa-miR-548k	PAR-CLIP	22100165
MIRT447508	hsa-miR-8054	PAR-CLIP	22100165
MIRT447507	hsa-miR-548l	PAR-CLIP	22100165
MIRT447506	hsa-miR-4635	PAR-CLIP	22100165
MIRT447505	hsa-miR-7158-3p	PAR-CLIP	22100165
MIRT447504	hsa-miR-203b-3p	PAR-CLIP	22100165

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IEA
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005763	Component	Mitochondrial small ribosomal subunit	IBA
GO:0005763	Component	Mitochondrial small ribosomal subunit	IDA	25838379
GO:0005763	Component	Mitochondrial small ribosomal subunit	IEA
GO:0005763	Component	Mitochondrial small ribosomal subunit	NAS	25838379
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IBA
GO:0006412	Process	Translation	IEA
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 611972
• HGNC: 14498
• e!Ensembl: ENSG00000144029

Protein

• UniProt ID: P82675
• Protein name: Small ribosomal subunit protein uS5m (28S ribosomal protein S5, mitochondrial) (MRP-S5) (S5mt)
• PDB: 3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00333	Ribosomal_S5	218 → 283	Ribosomal protein S5, N-terminal domain	Domain
  PF03719	Ribosomal_S5_C	295 → 366	Ribosomal protein S5, C-terminal domain	Domain

• Sequence:

  MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPY
  ASLSRALQTQCCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKK
  KKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWD
  RKKKMKVKRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKS
  IRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHDISLRFKR
  THIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLFRGLSRQETHQ
  QLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRS
  VWSNLKRAAT

• Sequence length: 430

Pathways

KEGG Pathway	Reactome Pathway
Ribosome	Mitochondrial translation elongation
	Mitochondrial translation termination

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Squamous cell lung carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (8)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	27602772		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	39636315	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	36949106	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	36949106	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	36949106	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	33362202	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30901096		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30901096		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MRPL28 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL3 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL10 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL21 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL13 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MRPL28	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL3	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL10	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL21	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL13	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 2 of 5 related genesMRPL10, MRPL21 Bone fracture Linked via 1 of 5 related genesMRPL28 Combined oxidative phosphorylation deficiency Linked via 1 of 5 related genesMRPL3 Mitochondrial disease Linked via 1 of 5 related genesMRPL3 Metabolic syndrome Linked via 1 of 5 related genesMRPL21

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	2	["MRPL10","MRPL21"]
Bone fracture	1	["MRPL28"]
Combined oxidative phosphorylation deficiency	1	["MRPL3"]
Mitochondrial disease	1	["MRPL3"]
Metabolic syndrome	1	["MRPL21"]