MRPS18A (mitochondrial ribosomal protein S18A)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55168
• Gene name: Mitochondrial ribosomal protein S18A
• Gene symbol: MRPS18A
• Synonyms (NCBI Gene): HumanS18b, MRP-S18-3, MRP-S18-a, MRPS18-3, S18bmt, S18mt-a, mL66
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

miRNA Show/Hide all (162)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042514	hsa-miR-423-3p	CLASH	23622248
MIRT440213	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440213	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT2045920	hsa-miR-1251	CLIP-seq
MIRT2045921	hsa-miR-1323	CLIP-seq
MIRT2045922	hsa-miR-146b-3p	CLIP-seq
MIRT2045923	hsa-miR-2355-5p	CLIP-seq
MIRT2045924	hsa-miR-3117-5p	CLIP-seq
MIRT2045925	hsa-miR-3147	CLIP-seq
MIRT2045926	hsa-miR-3173-5p	CLIP-seq
MIRT2045927	hsa-miR-4421	CLIP-seq
MIRT2045928	hsa-miR-4763-5p	CLIP-seq
MIRT2045929	hsa-miR-548o	CLIP-seq
MIRT2045930	hsa-miR-874	CLIP-seq
MIRT2045922	hsa-miR-146b-3p	CLIP-seq
MIRT2045926	hsa-miR-3173-5p	CLIP-seq
MIRT2045928	hsa-miR-4763-5p	CLIP-seq
MIRT2045930	hsa-miR-874	CLIP-seq
MIRT2454491	hsa-miR-2392	CLIP-seq
MIRT2454492	hsa-miR-3605-5p	CLIP-seq
MIRT2454493	hsa-miR-3649	CLIP-seq
MIRT2454494	hsa-miR-4709-3p	CLIP-seq
MIRT2573916	hsa-miR-1207-3p	CLIP-seq
MIRT2045920	hsa-miR-1251	CLIP-seq
MIRT2573917	hsa-miR-1286	CLIP-seq
MIRT2573918	hsa-miR-1299	CLIP-seq
MIRT2573919	hsa-miR-1302	CLIP-seq
MIRT2045921	hsa-miR-1323	CLIP-seq
MIRT2045922	hsa-miR-146b-3p	CLIP-seq
MIRT2573920	hsa-miR-15a	CLIP-seq
MIRT2573921	hsa-miR-15b	CLIP-seq
MIRT2573922	hsa-miR-16	CLIP-seq
MIRT2573923	hsa-miR-195	CLIP-seq
MIRT2573924	hsa-miR-1972	CLIP-seq
MIRT2573925	hsa-miR-2114	CLIP-seq
MIRT2045923	hsa-miR-2355-5p	CLIP-seq
MIRT2573926	hsa-miR-3065-3p	CLIP-seq
MIRT2573927	hsa-miR-31	CLIP-seq
MIRT2045924	hsa-miR-3117-5p	CLIP-seq
MIRT2573928	hsa-miR-3126-5p	CLIP-seq
MIRT2573929	hsa-miR-3128	CLIP-seq
MIRT2045925	hsa-miR-3147	CLIP-seq
MIRT2045926	hsa-miR-3173-5p	CLIP-seq
MIRT2573930	hsa-miR-3189-5p	CLIP-seq
MIRT2573931	hsa-miR-331-3p	CLIP-seq
MIRT2573932	hsa-miR-338-3p	CLIP-seq
MIRT2573933	hsa-miR-339-5p	CLIP-seq
MIRT2573934	hsa-miR-342-5p	CLIP-seq
MIRT2573935	hsa-miR-3928	CLIP-seq
MIRT2573936	hsa-miR-3944-5p	CLIP-seq
MIRT2573937	hsa-miR-424	CLIP-seq
MIRT2573938	hsa-miR-4298	CLIP-seq
MIRT2573939	hsa-miR-4310	CLIP-seq
MIRT2573940	hsa-miR-4318	CLIP-seq
MIRT2573941	hsa-miR-4323	CLIP-seq
MIRT2573942	hsa-miR-4325	CLIP-seq
MIRT2045927	hsa-miR-4421	CLIP-seq
MIRT2573943	hsa-miR-4433	CLIP-seq
MIRT2573944	hsa-miR-4443	CLIP-seq
MIRT2573945	hsa-miR-4459	CLIP-seq
MIRT2573946	hsa-miR-4475	CLIP-seq
MIRT2573947	hsa-miR-4519	CLIP-seq
MIRT2573948	hsa-miR-4524	CLIP-seq
MIRT2573949	hsa-miR-4529-5p	CLIP-seq
MIRT2573950	hsa-miR-4540	CLIP-seq
MIRT2573951	hsa-miR-455-5p	CLIP-seq
MIRT2573952	hsa-miR-4640-3p	CLIP-seq
MIRT2573953	hsa-miR-4648	CLIP-seq
MIRT2573954	hsa-miR-4651	CLIP-seq
MIRT2573955	hsa-miR-4664-5p	CLIP-seq
MIRT2573956	hsa-miR-4670-3p	CLIP-seq
MIRT2573957	hsa-miR-4680-5p	CLIP-seq
MIRT2573958	hsa-miR-4693-5p	CLIP-seq
MIRT2573959	hsa-miR-4722-5p	CLIP-seq
MIRT2573960	hsa-miR-4724-5p	CLIP-seq
MIRT2045928	hsa-miR-4763-5p	CLIP-seq
MIRT2573961	hsa-miR-4781-3p	CLIP-seq
MIRT2573962	hsa-miR-4793-3p	CLIP-seq
MIRT2573963	hsa-miR-497	CLIP-seq
MIRT2573964	hsa-miR-503	CLIP-seq
MIRT2573965	hsa-miR-541	CLIP-seq
MIRT2045929	hsa-miR-548o	CLIP-seq
MIRT2573966	hsa-miR-552	CLIP-seq
MIRT2573967	hsa-miR-608	CLIP-seq
MIRT2573968	hsa-miR-646	CLIP-seq
MIRT2573969	hsa-miR-654-5p	CLIP-seq
MIRT2573970	hsa-miR-671-5p	CLIP-seq
MIRT2573971	hsa-miR-711	CLIP-seq
MIRT2573972	hsa-miR-764	CLIP-seq
MIRT2045930	hsa-miR-874	CLIP-seq
MIRT2573973	hsa-miR-875-3p	CLIP-seq
MIRT2573974	hsa-miR-892a	CLIP-seq
MIRT2573916	hsa-miR-1207-3p	CLIP-seq
MIRT2045920	hsa-miR-1251	CLIP-seq
MIRT2573917	hsa-miR-1286	CLIP-seq
MIRT2573918	hsa-miR-1299	CLIP-seq
MIRT2573919	hsa-miR-1302	CLIP-seq
MIRT2045921	hsa-miR-1323	CLIP-seq
MIRT2045922	hsa-miR-146b-3p	CLIP-seq
MIRT2573920	hsa-miR-15a	CLIP-seq
MIRT2573921	hsa-miR-15b	CLIP-seq
MIRT2573922	hsa-miR-16	CLIP-seq
MIRT2573923	hsa-miR-195	CLIP-seq
MIRT2573924	hsa-miR-1972	CLIP-seq
MIRT2573925	hsa-miR-2114	CLIP-seq
MIRT2045923	hsa-miR-2355-5p	CLIP-seq
MIRT2573926	hsa-miR-3065-3p	CLIP-seq
MIRT2573927	hsa-miR-31	CLIP-seq
MIRT2045924	hsa-miR-3117-5p	CLIP-seq
MIRT2573928	hsa-miR-3126-5p	CLIP-seq
MIRT2573929	hsa-miR-3128	CLIP-seq
MIRT2045925	hsa-miR-3147	CLIP-seq
MIRT2045926	hsa-miR-3173-5p	CLIP-seq
MIRT2573930	hsa-miR-3189-5p	CLIP-seq
MIRT2573931	hsa-miR-331-3p	CLIP-seq
MIRT2573932	hsa-miR-338-3p	CLIP-seq
MIRT2573933	hsa-miR-339-5p	CLIP-seq
MIRT2573934	hsa-miR-342-5p	CLIP-seq
MIRT2573935	hsa-miR-3928	CLIP-seq
MIRT2573936	hsa-miR-3944-5p	CLIP-seq
MIRT2573937	hsa-miR-424	CLIP-seq
MIRT2573938	hsa-miR-4298	CLIP-seq
MIRT2573939	hsa-miR-4310	CLIP-seq
MIRT2573940	hsa-miR-4318	CLIP-seq
MIRT2573941	hsa-miR-4323	CLIP-seq
MIRT2573942	hsa-miR-4325	CLIP-seq
MIRT2045927	hsa-miR-4421	CLIP-seq
MIRT2573943	hsa-miR-4433	CLIP-seq
MIRT2573944	hsa-miR-4443	CLIP-seq
MIRT2573945	hsa-miR-4459	CLIP-seq
MIRT2573946	hsa-miR-4475	CLIP-seq
MIRT2573947	hsa-miR-4519	CLIP-seq
MIRT2573948	hsa-miR-4524	CLIP-seq
MIRT2573949	hsa-miR-4529-5p	CLIP-seq
MIRT2573950	hsa-miR-4540	CLIP-seq
MIRT2573951	hsa-miR-455-5p	CLIP-seq
MIRT2573952	hsa-miR-4640-3p	CLIP-seq
MIRT2573953	hsa-miR-4648	CLIP-seq
MIRT2573954	hsa-miR-4651	CLIP-seq
MIRT2573955	hsa-miR-4664-5p	CLIP-seq
MIRT2573956	hsa-miR-4670-3p	CLIP-seq
MIRT2573957	hsa-miR-4680-5p	CLIP-seq
MIRT2573958	hsa-miR-4693-5p	CLIP-seq
MIRT2573959	hsa-miR-4722-5p	CLIP-seq
MIRT2573960	hsa-miR-4724-5p	CLIP-seq
MIRT2045928	hsa-miR-4763-5p	CLIP-seq
MIRT2573961	hsa-miR-4781-3p	CLIP-seq
MIRT2573962	hsa-miR-4793-3p	CLIP-seq
MIRT2573963	hsa-miR-497	CLIP-seq
MIRT2573964	hsa-miR-503	CLIP-seq
MIRT2573965	hsa-miR-541	CLIP-seq
MIRT2045929	hsa-miR-548o	CLIP-seq
MIRT2573966	hsa-miR-552	CLIP-seq
MIRT2573967	hsa-miR-608	CLIP-seq
MIRT2573968	hsa-miR-646	CLIP-seq
MIRT2573969	hsa-miR-654-5p	CLIP-seq
MIRT2573970	hsa-miR-671-5p	CLIP-seq
MIRT2573971	hsa-miR-711	CLIP-seq
MIRT2573972	hsa-miR-764	CLIP-seq
MIRT2045930	hsa-miR-874	CLIP-seq
MIRT2573973	hsa-miR-875-3p	CLIP-seq
MIRT2573974	hsa-miR-892a	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	ISS	11402041
GO:0003735	Function	Structural constituent of ribosome	NAS	11279123
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	28892042
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005762	Component	Mitochondrial large ribosomal subunit	IDA	28892042
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	25278503
GO:0005763	Component	Mitochondrial small ribosomal subunit	IBA
GO:0005763	Component	Mitochondrial small ribosomal subunit	IDA	11279123, 25838379
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IBA
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	NAS	11279123
GO:0032543	Process	Mitochondrial translation	ISS	11402041
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:0070181	Function	Small ribosomal subunit rRNA binding	IBA
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 611981
• HGNC: 14515
• e!Ensembl: ENSG00000096080

Protein

• UniProt ID: Q9NVS2
• Protein name: Large ribosomal subunit protein mL66 (39S ribosomal protein S18-3, mitochondrial) (MRP-S18-3) (39S ribosomal protein S18a, mitochondrial) (MRP-S18-a) (Mrps18a) (S18mt-a) (Large ribosomal subunit protein bS18a)
• PDB: 3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01084	Ribosomal_S18	77 → 128	Ribosomal protein S18	Family

• Sequence:

  MAALKALVSGCGRLLRGLLAGPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKES
  PNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVK
  MAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPL
  LRDNVCYSRTPWKLYH

• Sequence length: 196

Pathways

KEGG Pathway	Reactome Pathway
Ribosome	Mitochondrial translation elongation
	Mitochondrial translation termination

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MRPL28 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL3 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL10 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL21 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation. MRPL13 3 shared pathwaysRibosome, Mitochondrial translation elongation, Mitochondrial translation termination Related via 3 shared pathways including Ribosome, Mitochondrial translation elongation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MRPL28	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL3	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL10	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL21	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL13	0	[]	3	["Ribosome","Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 2 of 5 related genesMRPL10, MRPL21 Bone fracture Linked via 1 of 5 related genesMRPL28 Combined oxidative phosphorylation deficiency Linked via 1 of 5 related genesMRPL3 Mitochondrial disease Linked via 1 of 5 related genesMRPL3 Metabolic syndrome Linked via 1 of 5 related genesMRPL21

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	2	["MRPL10","MRPL21"]
Bone fracture	1	["MRPL28"]
Combined oxidative phosphorylation deficiency	1	["MRPL3"]
Mitochondrial disease	1	["MRPL3"]
Metabolic syndrome	1	["MRPL21"]